KEGG   Brassica rapa (field mustard): 103837563Help
Entry
103837563         CDS       T03449                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 2, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00071  Fatty acid degradation
brp00410  beta-Alanine metabolism
brp00592  alpha-Linolenic acid metabolism
brp00640  Propanoate metabolism
brp01040  Biosynthesis of unsaturated fatty acids
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01212  Fatty acid metabolism
brp04146  Peroxisome
Module
brp_M00087  beta-Oxidation
brp_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    103837563
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103837563
   00592 alpha-Linolenic acid metabolism
    103837563
   01040 Biosynthesis of unsaturated fatty acids
    103837563
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103837563
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103837563
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     103837563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-GeneID: 103837563
NCBI-ProteinID: XP_009112168
UniProt: A0A397Y0F6
Position
A9
AA seq 680 aa AA seqDB search
MALEEFSEIAAARRIQRLSSHISPALTEPPQLQTEACSSRTRKLVVNGQALSLYMKGKHR
DIQEKVHEFYNSRPDLQTPLEISKDDHRELCMRQLYALVREAGIRPFRYVADDPAKYFAI
MEAVGSVDMSFGIKMGVQYSLWGGSVINLGTKKHRDKYFDGIDNLDYLGCFAMTELHHGS
NVQGLQTTATFDPITDEFIIDTPHDGAIKWWIGNAAVHGKFATVFARLILPTHDTKGVSD
MGVHAFIVPIRDMKTHQTLPGVEIQDCGQKVGLNGVDNGALRFRSVRIPRDNLLNRFGDV
SRDGKYTSSLPTINKRFGATLGELVGGRVALAYSSVGVLKVSATIAIRYSLLRQQFGPPK
QPEVSILDYQSQQHKLMPMLASTYAYHFATVYLVEKYSEMKKTNDEQLVADVHALSAGLK
SYITSYTAKSLSVCREACGGHGYAAVNRFGGLRNDHDIFQTFEGDNTVLLQQVAADLLKR
YKEKFQGGTLTVTWSYLRESMSSYLAQPNPVTARWEGEDHLRDPKFQLDAFRYRTSRLLQ
SVAMRLKKHSKTLGTFGAWNRCLNHLLTLAESHIETVILAKFIEAVRKCPDPSARAGLKL
VCDLYALDRIWNDIGTYRNVDYVAPNKAKAIHKLAEYLSFQVRNVAKELVDAFELPDHVT
RAPIAMQADAYSQYTQVVGF
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcgttggaagagttttccgagatagctgcggcgaggaggattcagagactgtcgtca
catatctctcccgctttaacggagccgccgcagctgcagacggaggcgtgctcttcgcgg
acgaggaagctggtggtcaacggtcaggcgttgtctctctacatgaaggggaagcacagg
gatattcaggagaaagtgcacgagttctacaactctcgtcccgatttgcagacgccgctc
gagatctccaaggacgatcatcgagagttgtgtatgaggcagctatatgcgcttgtgaga
gaagctggtataaggccgtttaggtatgtggctgatgatccggccaagtattttgcgatc
atggaagctgttgggagtgtggatatgtcgtttgggatcaagatgggtgttcaatacagt
ctttggggaggctctgtgatcaacttgggaacaaagaagcatagagacaagtatttcgat
ggcattgacaatctagactacctcggttgctttgctatgactgaactccaccatggttca
aatgttcaaggtctccagaccacggccacatttgatcccatcacagacgagttcataatc
gacacaccacacgatggagccatcaaatggtggataggaaacgccgcagttcacggaaaa
ttcgccacagttttcgccaggctcatccttccaacgcacgacaccaaaggagtctcagac
atgggcgttcacgccttcatagtccccataagagacatgaaaacacaccagaccctccca
ggcgtcgagattcaagactgcggacagaaagtaggtctgaacggagtcgacaacggggct
ttgcggttccgttccgtgagaatcccacgtgacaatctcctcaaccgcttcggagatgtg
tcacgagacggcaagtacacaagcagcttaccaacgatcaacaaaagattcggtgcaaca
ctcggtgagcttgtaggtggacgagtggctcttgcttactcatccgttggtgtactcaaa
gtctcggccactattgctatacgttactcgttgttaagacaacagtttggtcctccgaag
caacctgaggttagtattcttgattaccagtctcaacaacacaagttaatgcccatgttg
gcttctacctatgcgtaccatttcgcaactgtgtacctcgtggagaaatattcggagatg
aagaagactaacgatgagcagttagttgctgatgtccatgcgctatctgctggtctcaaa
tcttatataacgtcttacacggctaagtcgctctcggtctgtagagaagcttgtggagga
catggttatgcagctgttaaccggtttggaggcttgaggaatgatcatgatatattccaa
acgtttgaaggagacaacacagtgcttctacaacaggtggctgctgatttactgaagaga
tacaaagagaagttccaaggtgggacattaacagtcacatggagttacttgagagaatcg
atgagctcttatttggctcagccaaatccagttacagctcgttgggagggtgaagatcat
ctaagagatcctaagttccaactagatgctttccggtatcgaacatcacgtctcctacaa
agtgtggcaatgcgtttgaagaaacacagcaagacacttggaacattcggtgcatggaac
agatgcttgaaccatctcttgacactagcagaatctcacattgaaacagtcattctcgcc
aagttcattgaagctgttagaaagtgtccggacccaagtgcaagagctggtctgaaacta
gtatgtgatctttacgcattggaccgaatatggaatgatataggaacgtaccgtaacgtg
gactatgtggcgcctaacaaagccaaggcgattcataagttggctgagtatttgagtttc
caagtaaggaacgtggccaaggagctagtggacgcgttcgagctgcctgatcacgttact
cgagcgcctattgctatgcaagctgatgcttattcacagtatactcaagttgttggattc
tga

DBGET integrated database retrieval system