KEGG   Brassica rapa (field mustard): 103838003Help
Entry
103838003         CDS       T03449                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00350  Tyrosine metabolism
brp00360  Phenylalanine metabolism
brp00380  Tryptophan metabolism
brp00901  Indole alkaloid biosynthesis
brp00950  Isoquinoline alkaloid biosynthesis
brp00965  Betalain biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103838003
   00360 Phenylalanine metabolism
    103838003
   00380 Tryptophan metabolism
    103838003
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    103838003
   00950 Isoquinoline alkaloid biosynthesis
    103838003
   00965 Betalain biosynthesis
    103838003
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brp04147]
    103838003
Enzymes [BR:brp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103838003
    4.1.1.105  L-tryptophan decarboxylase
     103838003
Exosome [BR:brp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103838003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5 RBD
Motif
Other DBs
NCBI-GeneID: 103838003
NCBI-ProteinID: XP_009112658
Position
A9
AA seq 490 aa AA seqDB search
MENGSRHVLKPMDSEQLREYGHRMVDFIADYYKTIESFPVLSQVQPGYLHNLLPDSAPDH
PETVEQVLDDVKTKILPGVTHWQSPNFFAYYPSNSSVAGFLGEMLSAGVGIVGFSWVTSP
AATELEMIVLDWLAKLLNLPEHFLSKGNGGGVIQGSASEAILVVMIAARDKVLRSAGKNS
LGKLVVYSSDQTHSALQKACQIAGIHPENCRVLKADSSTNYALRPELLQEAVSRDLEAGL
IPFFLCGNVGTTSSAAVDPLAALGKIAKSNEIWFHVDAAYAGSACICPEYRQYIDGVETA
DSFNMNAHKWFLTNFDCSLLWVKDQHALTEALSTNPEFLKNKASQANLVVDYKDWQIPLG
RRFRSLKLWMVLRLYGAETLKNYIRNHIKLAKDLEQLVSQDPNFEVITPRIFSLVCFRIV
PTDNDEKKCNSRNLELLEAVNSSGKLFISHTALSGKIVLRCAIGAPLTEEKHVKETWKVI
QEKVSYLLRK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggtagtaggcacgtgctgaagccgatggactctgagcaactgagagagtac
ggacatcgaatggtggacttcattgctgattattacaaaactatcgaatctttccctgtc
cttagccaagttcagcctggttatcttcacaaccttttgcctgattcagcaccagaccac
cctgaaacagttgaacaagttcttgatgatgttaaaacgaagatattgcctggagtaact
cactggcaaagccccaacttctttgcttattacccgtctaacagcagcgttgcagggttc
ttgggtgagatgttgagtgctggtgttggaattgttggttttagttgggtaacgtctcca
gctgccactgagctcgaaatgatcgttcttgattggcttgccaaacttctaaacctaccc
gagcattttctctccaaaggaaatggaggtggagtcattcaagggtcagctagtgaagct
attcttgttgttatgattgctgcccgcgataaggtcttaagaagcgctggcaagaactcc
cttgggaagctcgttgtctactcctctgaccagacacattcagctctacagaaagcttgc
cagatagctggaatccatccggagaattgtagggtgctgaaagcagattcctctacaaat
tatgctctgcgtccagaattgcttcaagaagccgtttctcgggatcttgaagctggattg
attcctttcttcttgtgtggcaatgttggaacaacttcttcagcagcagttgatccacta
gccgcactgggaaagattgcaaagagcaatgagatatggtttcacgtggacgcagcgtac
gctggaagtgcttgtatatgtccagagtatagacagtacatagacggagtagaaactgca
gactcatttaacatgaatgctcacaaatggttcctcaccaacttcgattgttccctgctt
tgggtgaaggatcagcatgctctcactgaagctctgtcaacaaatccagagtttctcaaa
aacaaggcctctcaggcaaacttagttgttgattacaaagactggcagatccctctcgga
cgaagattcagatcattgaaactatggatggttttaaggctctatggagctgagactttg
aagaactatataagaaaccacatcaagctggctaaagatcttgaacaacttgtctctcaa
gatcctaactttgaggttatcactcctcggatcttttctctcgtctgctttcgtatcgtt
cctaccgataacgatgaaaagaagtgtaatagtcgaaaccttgagctcctagaggcagta
aattcctcagggaaactcttcatttctcacactgctttgtcgggaaaaatcgttctacgt
tgtgccattggagcgccgttgacagaggagaagcacgtgaaggagacatggaaggttatt
caggaaaaagtatcttacttgcttcgcaagtaa

DBGET integrated database retrieval system