KEGG   Brassica rapa (field mustard): 103839367Help
Entry
103839367         CDS       T03449                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00970  Aminoacyl-tRNA biosynthesis
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103839367
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:brp03029]
    103839367
Enzymes [BR:brp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     103839367
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     103839367
Mitochondrial biogenesis [BR:brp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    103839367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 103839367
NCBI-ProteinID: XP_009114120
Position
A9
AA seq 538 aa AA seqDB search
MLSTLQPPRSLTLLPFRRFHGSKTIASLASSSPTLDASSVSPPQSQILTTRRSLLSGETT
ASEIAKSYLSRIRLTEPQLKCFLHVSENVLKEAQEIDQRISRGEEVGPLAGVVIGVKDNI
CTEGMPSTAASRILEHYRPPFDATAVKKIKEMGGIVVGKTNMDEFGMGSTTEASAFQVTA
NPWDLTRVPGGSSGGSAAAVAARQCMVSLGSDTGGSVRQPASFCGVVGLKPTYGRVSRFG
LMAYASSLDVIGCFGSTVADAGMLLHAVSGYDRFDSTSSKQDVPEFDTQFLSMDSFESKP
LKGVRVGLIRETLEEGVDSGVRSATQEAASHLEALGCVVTEVSLPSFSLGLPAYYVIASS
ESSSNLSRYDGVRYGNQVMADELNKLYECSRGQGFGGEVKMRILMGTYALSAGYYDAYYK
RAQQVRTLIRKDFKAALDHNDILISPAAPSAAYKIGEKKDDPLAMYAGDIMTVNVNLAGL
PAIVLPCGLVEGGPSGLPVGLQMIGAAFDEEKLLKVGHIFEQTLKGSGFVPPTLPNVA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttatcgacattgcagccgccgcgctctctcactctcctccctttccgacgattccac
ggctccaaaacaatcgcatccctagcttcttcctctccgaccctcgacgcttcctccgtc
tctcctccacaatcccagatcctcaccactcgtcgctctctcctctccggcgaaaccaca
gcttccgagatcgcgaaatcttacctctcccgcatccgtctcaccgagcctcagctcaaa
tgcttcctccacgtgtccgagaacgttctcaaagaggctcaagagatagaccagagaatc
tccagaggcgaggaagtgggccctctcgccggagttgtgatcggcgtcaaggataacatc
tgcactgaaggtatgccttccaccgccgcttctcgcatcctagagcattaccgtcctccg
ttcgacgccacggcggtgaagaagatcaaggagatgggagggatcgttgttgggaaaacc
aatatggatgagttcggaatgggaagcacaactgaagcttctgcctttcaggtaactgcg
aatccatgggacttgacacgtgtaccgggaggttcatcaggaggctcagcagcagctgtt
gcggcgagacaatgtatggtgtctcttgggagtgatactggtgggagcgtgaggcagcca
gcttccttctgtggtgtcgttggacttaagcctacttatgggcgtgtttctaggtttgga
cttatggcttacgcatcttcgttggatgtgattggttgctttggctctacggttgctgat
gctgggatgcttcttcatgctgtttctgggtatgataggtttgactccaccagtagcaaa
caagatgtgcctgagtttgatacacagtttctttctatggattcttttgaatctaaacca
ttaaagggggtgagagttggtctcattcgcgagacgcttgaagaaggtgttgattctgga
gtgagatctgcaactcaggaagctgcttctcatttagaagcattgggttgtgtagtaaca
gaggtctctcttccttcattctctcttggactaccagcttactatgtgattgcctcatct
gaatcatcttccaatctatcacgttatgatggtgtcagatatgggaatcaagttatggct
gacgagctcaataagttgtatgaatgttcgcgtggtcaaggatttggcggggaggtgaaa
atgaggattttaatgggaacatatgcactctcggctggttactacgatgcatactacaag
cgagcacaacaggtgagaacactaattagaaaagacttcaaagcggcgttagatcataat
gatatccttatctcacccgcagctccgtctgctgcatacaagattggtgaaaagaaagat
gatccattggcaatgtatgctggagacattatgacggttaatgtaaatcttgcaggactt
cctgcgattgtattaccatgtggattagttgaaggaggtccctcgggtttaccggttggt
cttcaaatgattggtgcagcctttgatgaggagaaattgctgaaagttggtcacatattt
gagcagactctcaaaggttcaggctttgttcctccaacgttgccaaatgtagcctaa

DBGET integrated database retrieval system