KEGG   Brassica rapa (field mustard): 103839780Help
Entry
103839780         CDS       T03449                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
brp  Brassica rapa (field mustard)
Brite
KEGG Orthology (KO) [BR:brp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103839780
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     103839780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_6 DAO Pyr_redox_3 EF-hand_7 EF-hand_5 EF-hand_8 p25-alpha
Motif
Other DBs
NCBI-GeneID: 103839780
NCBI-ProteinID: XP_009114515
UniProt: A0A397Y3R5
Position
A9
AA seq 579 aa AA seqDB search
MRRSFSFFERFSKAFQDYPSLSRIIVVSTISGGGLIAYSEANGTNGVVETGTKKKKVVLL
GTGWAGTSFLKNLNNSQYEVQIISPRNYFAFTPLLPSVTCGTVEARSVVEPIRNIGRKKN
VDTSYLEAECFKIDPASKKVFCRSKQGVSSGKKEEFSVDYDYLVIATGAQSNTFNIPGVE
ENCHFLKEVEDAQGIRKKVIDSFEKASLPELSEEERKRILHFVVVGGGPTGVEFAAELHD
FVTEDLVTLYPKAKDLVRITLLEAADHILTMFDKRITEFAEEKFSRDGIDVKLGSMVTKV
NEKDISAKTKGGEVSSIPYGMIVWSTGIGTRPVIKDFMKQIGQGNRRALATDEWLRVEGC
DNIYALGDCATINQRKVMEDVSAIFSKADKDNSGTLTLKEFQEAMDDICVRYPQVELYLK
SKRMRGIADLLKEAEADDGSKKNIELKIEEFKSALSQVDSQVKFLPATAQVAAQQGTYLA
KCFDRMEECEKNPEGPIRMRGEGRHRFRPFRYRHLGSFAPLGGEQTAAELPGDWVSIGHS
SQWLWYSVYASKQVSWRTRVLVVSDWMRRFIFGRDSSSI
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggagtttcagtttcttcgagcgattctcgaaagctttccaagattatccttcc
ctctccaggatcatcgtcgtctccacgatcagtggtggaggacttatagcctactccgag
gcaaatggaacaaacggtgttgttgaaactggaaccaagaagaagaaggtggtgctgctc
ggaactggatgggctggaactagtttcttaaagaatttgaataactctcagtatgaggtt
cagattatatcgcctcgaaactactttgctttcactcccttgctgcctagcgttacttgt
ggcactgttgaagctcgcagcgttgttgagcctattcgaaacattggcagaaagaagaac
gttgatacgtcttacctggaggctgaatgtttcaagattgatccagcaagcaagaaagtg
ttctgccgatccaaacaaggcgttagcagtgggaagaaagaagaattttctgttgactat
gactaccttgtaattgctactggagctcagtctaacacttttaacatacctggagtggag
gagaactgtcattttctcaaagaggttgaagatgctcaaggaatccgtaaaaaggtgatt
gattccttcgagaaggcaagtctaccggaactaagcgaggaagagaggaagagaatcctc
cattttgtggttgttggtggtgggccaacaggtgttgagtttgccgcggagctgcatgat
tttgttacagaggatctagtcacactctatcctaaagccaaagatctagtgcgaatcacg
cttctggaggccgcagaccacatactgactatgtttgacaagagaatcactgagtttgcc
gaagaaaagtttagcagagatggtattgatgtgaaacttggctccatggtgaccaaagtg
aatgaaaaggatatatctgctaaaaccaaaggaggagaggtttcctcaattccttatggt
atgattgtctggtcaactggtattggaactcgtccggtgatcaaagattttatgaaacaa
attggccagggtaacagacgtgctctggccactgatgaatggcttcgcgtggaaggttgt
gataacatatatgcccttggtgattgcgcaacaattaaccagcgtaaagtcatggaagat
gtttctgcgatctttagcaaagcagacaaagacaattctgggacgctgactctgaaagag
tttcaagaagcaatggatgacatttgtgttagataccctcaagtggagctctacttgaag
agtaaacgtatgcgtggcattgctgatcttctaaaggaagctgaagctgatgatggatcc
aagaagaacatagagttgaagatcgaagagttcaaatcggctctttctcaggttgactcg
caagtgaagtttcttccagcaacagcacaggttgctgcgcagcaaggcacataccttgca
aaatgctttgatcgtatggaagagtgtgagaagaatccagaaggtcccattaggatgaga
ggagaaggtcgtcaccgtttccgccccttcaggtataggcatttgggatcattcgcacca
ttgggtggggaacaaacggcggcagaacttccaggagattgggtttctattggacacagc
agccagtggctctggtattccgtttacgccagtaagcaagtgagctggcgcacgagagtc
cttgttgtttctgattggatgaggcgtttcatctttggtagagactcaagtagcatctga

DBGET integrated database retrieval system