KEGG   Brassica rapa (field mustard): 103841591Help
Entry
103841591         CDS       T03449                                 

Definition
(RefSeq) probable protein S-acyltransferase 1
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
brp  Brassica rapa (field mustard)
Brite
Enzymes [BR:brp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103841591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 103841591
NCBI-ProteinID: XP_009116393
Position
A9
AA seq 332 aa AA seqDB search
MSCQNHERKRIYQVWPGKNKFLCGGRLVFGPDASSLLLTTCMIGGPSITFCIRIAFLIGD
RRPLFHSLIMIGAALLTIMDFTFLFLTSTRDPGIIPRSKEAPTLEWASNKAKLPRTKDII
VNGFTVKVKFCDTCKLYRPPRASHCSTCNNCVQRFDHHCPWVGQCIALRNYPFFVCFISC
STLLCIYIFAFSLVSMLEVHGQFYLLIADDLILGVLALYCFVSVWFVGGLTVFHFYLICT
NQTTSESFRYHYDKKENPYRKGVLKNFKELLLGKIPPPLVNFRDWVQEEDVEVGSIASEV
VRAFGLRDMEMSSSKPGHGSCNYGPSEAGVWN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtcagaatcatgagcgtaaaaggatttatcaagtctggcccggcaaaaataaa
tttttatgcggggggagactagtgtttggtccagacgcatcttctcttcttttgaccaca
tgtatgataggaggcccatctatcactttttgcatcagaatagctttcttgatcggagat
cgccgccctttattccattctctgattatgattggtgcagctcttctcacaatcatggac
ttcacgtttctcttcttgacatcaacgagagaccctgggatcatcccaaggagcaaagaa
gctcctacacttgaatgggcgagtaacaaagcaaaactacctcgaacgaaagatataatt
gtgaatggcttcactgtaaaggttaagttctgtgatacatgtaagctataccgtcctcct
cgcgcctctcactgctcaacctgcaacaactgtgtccaaaggtttgatcatcattgccca
tgggtaggacagtgcatcgccttgcgtaactatccgttcttcgtatgtttcatatcatgt
tccacactcctctgcatctacatatttgccttctcattggtcagcatgcttgaagtccat
ggccaattctatctcctcatcgctgatgacttaatactaggtgttctcgctctttactgc
tttgtttccgtatggtttgttggtggacttactgtcttccacttctacttaatctgtacc
aaccagacgacgagtgagagttttcggtaccattatgataagaaggagaacccttacaga
aagggtgtattaaagaactttaaggagctgttattgggtaaaatcccaccacctttggta
aattttagagattgggtgcaagaagaagatgtggaggtgggttctattgcctcagaggtg
gtcagagcctttggtctccgagacatggaaatgagcagtagcaaaccaggtcatggtagc
tgcaattatgggccttcagaagctggagtatggaactaa

DBGET integrated database retrieval system