KEGG   Brassica rapa (field mustard): 103842076Help
Entry
103842076         CDS       T03449                                 

Definition
(RefSeq) xyloglucan 6-xylosyltransferase 1
  KO
K08238  xyloglucan 6-xylosyltransferase [EC:2.4.2.39]
Organism
brp  Brassica rapa (field mustard)
Brite
KEGG Orthology (KO) [BR:brp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:brp01003]
    103842076
Enzymes [BR:brp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.39  xyloglucan 6-xylosyltransferase
     103842076
Glycosyltransferases [BR:brp01003]
 Polysaccharide
  Structural polysaccharide
   103842076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_34 Nucleotid_trans DUF273
Motif
Other DBs
NCBI-GeneID: 103842076
NCBI-ProteinID: XP_009116931
Position
A9
AA seq 456 aa AA seqDB search
MIEKCLGTHRCRKLQRVWRQGKVTLLCLVLTVVVLRGTIGAGKFGTPEQDIEEIREHFFY
SRKRAEPHRVLVEISSETTSSTGDGNGNNYETFDFNKIFVDEGDEEKSEENRNKPYSLGP
KISDWDEQRRDWLKQNPSFPNFVAPNKPRVLLVTGSAPKPCENPVGDHYLLKSIKNKIDY
CRIHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEIEFLWWMDSDAMFTDMVFELPW
ERYEDYNLVMHGWNEMVYEQKNWIGLNTGSFLLRNSQWALDLLDAWAPMGPKGKVREEAG
KVLTRELKDRPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILVDRYEEMIE
SHKPGFGDHRWPLVTHFVGCKPCGKFGDYPVERCLRQMDRAFNFGDNQILQMYGFTHKSL
GSRRVKPTRNQTDRPLDAKDEFGLLHPSFKAVKLTT
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaagtgcttaggaacgcatcgctgtcggaaattacagagagtctggcgtcaa
ggaaaagtgacgctcctctgcctcgtcctcaccgtcgtcgtcctacgcggcacaatcgga
gccggtaagttcggtacgccggagcaagacatcgaggagatccgcgagcatttcttctac
tctcgcaaacgcgccgagcctcaccgcgttctcgtcgaaatctcatccgaaacgacgtcg
tccacgggagacggaaacggcaacaactacgagacgttcgatttcaacaagatattcgtc
gacgaaggagatgaagagaaatccgaagaaaaccggaataaaccgtactctctcggtccg
aagatctccgactgggatgagcagaggcgtgactggctcaaacaaaacccgagtttccca
aacttcgtggcgccgaacaagcctagggttcttctcgtcacgggctcagctcccaagccg
tgcgagaatcctgtgggagaccattacctcttgaaatcgatcaagaacaagatcgattac
tgtcggatccacggaatcgagatcttctacaacatggcgttgctcgacgctgagatggct
gggttctgggctaagcttccgttgattcggaaactgttgctgtcgcatcctgagatcgag
tttctatggtggatggacagtgatgcgatgtttacggacatggtgttcgagcttccgtgg
gagaggtacgaggattataatctcgtgatgcacggttggaacgagatggtttatgaacag
aagaattggattgggcttaatacgggaagtttcttgcttaggaactcgcaatgggccctt
gatttactcgacgcttgggctccaatgggcccgaaagggaaagtccgagaagaagcgggt
aaagtcttgacccgggagctcaaagaccgacccgctttcgaggctgacgatcagtcggcg
atggtttatcttttagctacggagagggagaaatggggagggaaagtgtatctggagagt
ggttattacttgcacggttattgggggattttggtggaccggtacgaggagatgattgag
agtcataaaccgggttttggagaccatcggtggccacttgtcacgcatttcgtcgggtgt
aaaccgtgcgggaaatttggtgattatccggtggaaaggtgtctacgtcagatggataga
gcgtttaattttggggacaatcagatccttcagatgtatgggttcactcataagtcgcta
gggagccggcgcgtgaaaccaacgcgcaatcagacggataggccgcttgatgccaaggac
gagtttgggttgcttcatccgtcgtttaaagcggtgaagctcacgacgtga

DBGET integrated database retrieval system