KEGG   Brassica rapa (field mustard): 103846681Help
Entry
103846681         CDS       T03449                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV6-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00052  Galactose metabolism
brp00500  Starch and sucrose metabolism
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103846681
   00500 Starch and sucrose metabolism
    103846681
Enzymes [BR:brp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103846681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 103846681
NCBI-ProteinID: XP_009121899
Position
A10
AA seq 544 aa AA seqDB search
MAQHGNGALNRTSFHFQPHRNWINDPNAPMYYKGFYHMFYQHNNLAPRFSEIMIWGHSVS
QDMVNWIQLEPAFVPTESFDRHSCWSGSATILPDGKPVILYTGLEEHEELDRRQVTVLAE
PKDASDPLLREWVKPKNNPVMLPPHDVPHDCFRDPTTGWQGQDGIWRVIVGAKEINTERG
MAVLYRSKDFVEWTKYPTPLLATQDTGMWECPDFFPVSLTGKEGVETSVNNASVKHVLKV
SFGGHDCYVIGTYSSESEDFAADSEFTNTTADLRYDHGTFYASKAFFDSVKNRRINWGWV
IETDSVEDDLEKGWSGLLSLPREMWLDTSGKRLIQWPIEEINYLRTKQVSLDNTHLAGCS
ILEISGITAAQADVEVTFDLPVLEGNPQVLDSDHVDDAVLFDRDSSVGCVYGPFGLLALA
TSDLSEQTAIFFKIIRRGNGYSVVMGSDENKSSLRDNARKSAHGTVLDIDPLHEKISLRC
LIDHSIIESYGAGGRNVITSRVYPKVAIGEAAKLYLFNDGTRGVNISSMEAWSMRNAEVN
LNAL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacacggaaacggcgcgctgaacaggacttccttccatttccaacctcataga
aactggatcaacgatccaaacgcgccaatgtattacaaaggattctaccatatgttctac
cagcacaataacttggctccccgattcagtgagataatgatatggggacactctgtttca
caagacatggtcaactggatccaactcgaaccagcctttgttcctactgagtcctttgac
agacacagctgctggtctggatccgccactatcctccctgatggcaaaccggtaattcta
tacactggactcgaggagcacgaggagcttgacagacgccaggttacagttcttgccgaa
cctaaggatgcttccgaccctctgcttcgtgagtgggtaaagccaaagaacaatcctgtg
atgcttccgccacacgacgtccctcacgattgtttccgtgaccctacgaccgggtggcaa
ggacaagatgggatatggagagttatcgtgggagctaaggagataaacactgagagagga
atggcggttttgtacagaagtaaagactttgtggaatggactaagtatccaactcctttg
cttgcgacacaagacacaggaatgtgggaatgccctgatttttttccggtttctctgacc
ggtaaagaaggtgtagagacatcggtgaacaatgctagtgtaaagcatgtcttgaaagtg
agttttggaggtcatgattgctatgttattggtacatactcttctgagagtgaagacttt
gcagctgattctgagttcactaacacaactgcggatttgaggtatgatcatggaacgttc
tatgcttctaaggccttctttgacagtgttaagaatcggaggatcaactggggatgggtt
atagagactgatagcgttgaagatgatctcgagaaaggatggtctggccttctgtctctt
cctagggagatgtggcttgacacaagtggaaagaggctgatacaatggccaatagaagaa
atcaactatcttaggactaaacaagttagcttggataacacgcatctcgcaggctgctcg
attcttgaaatatcaggcatcactgcagcacaagctgacgtagaagtgacttttgatctg
cctgttctggaaggcaacccccaagtacttgattctgatcatgttgatgatgcggttttg
ttcgaccgtgacagctcggttggatgtgtttatggaccttttgggttgctagcattggct
accagtgatttatctgaacaaactgcaattttcttcaaaataattcgtcgtggaaatgga
tattcggttgtaatgggcagcgatgagaataagtcttcgttgagagacaacgcaaggaaa
tctgcacatggaacagtcctagacattgatccactacatgagaagatatcattgagatgt
ttgattgatcactctattatagagagctatggagcaggaggaagaaatgtgattacttct
agggtgtatcccaaagtagcaattggtgaagcagctaagctttacttgttcaatgatgga
acaaggggtgtgaacatatcgtctatggaagcttggagcatgagaaatgctgaagtcaat
ttaaacgcactttaa

DBGET integrated database retrieval system