KEGG   Brassica rapa (field mustard): 103847559Help
Entry
103847559         CDS       T03449                                 

Definition
(RefSeq) probable protein S-acyltransferase 3
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
brp  Brassica rapa (field mustard)
Brite
Enzymes [BR:brp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103847559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC TAS2R
Motif
Other DBs
NCBI-GeneID: 103847559
NCBI-ProteinID: XP_009122900
Position
A10
AA seq 297 aa AA seqDB search
MVELVFTFLFLASARDPRIIPRNKTSVNLEDGSNSSLTQSMEWVNNKTPHLKIPRTKDVF
VNGYTIKVKFCETCLLYRPPRASHCSICNNCVQRFDHHCPWVGQCIAHRNYPVFICFIST
STLLCIYIFALSWINLIRQPGRLWSTMSHDIISVILIIYSFVSIWFVGGLTIFHVYLMST
NQTTYENFRSRYDKKENPYKRGLLKNVKEVLFAKIPPSQLDLRAMVPEEDDGSEYESEYS
SSIRYDNEKGGKLPKRVSPEKLNLDNIDISNEYKTAKDDASSELDPSFFSSQLDLPK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggtggagctggtgtttacgtttctattcttggcatcagctagagatccaagaatcatc
ccaagaaataaaacatcagtaaatcttgaagatggctcaaatagttccttgacacagtct
atggaatgggtcaacaacaaaactcctcatctcaagattcctagaacaaaagacgttttc
gttaacggctacactatcaaagtcaagttctgtgagacttgtttgctctaccgtccacca
cgtgcatcacactgctccatatgtaacaactgtgtccaacgctttgatcaccattgtcca
tgggttggacaatgcattgcccatagaaactacccggtcttcatctgcttcatctcaacg
tcaacgttgttatgcatatacatctttgcgttgtcatggatcaatctaatccgacagcct
gggagattgtggagtacaatgtctcatgacataatctctgtcattctcatcatctattca
ttcgtttctatctggttcgttggtggccttaccattttccacgtctatcttatgtctaca
aatcagacaacttatgagaattttcggtcccgttatgataagaaagaaaacccttacaag
agagggttgctgaagaacgttaaagaagtgttgttcgccaagatcccaccttctcaacta
gatctcagagcaatggtcccagaagaagatgacggatctgagtatgagtcagagtatagc
tcttccatcagatatgataatgaaaagggaggcaaactccctaaaagggtgagcccggag
aagcttaacttagataatattgacattagcaatgaatacaagacagctaaagatgatgct
tcttctgagcttgatccttctttcttctcatctcaactagacttgcctaagtaa

DBGET integrated database retrieval system