KEGG   Brassica rapa (field mustard): 103848812Help
Entry
103848812         CDS       T03449                                 

Definition
(RefSeq) 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00562  Inositol phosphate metabolism
brp01100  Metabolic pathways
brp04070  Phosphatidylinositol signaling system
brp04145  Phagosome
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103848812
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    103848812
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103848812
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:brp04131]
    103848812
Enzymes [BR:brp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     103848812
Membrane trafficking [BR:brp04131]
 Endocytosis
  Macropinocytosis
   Kinases
    103848812
 Endosome - Golgi transport
  Others
   Others
    103848812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Cpn60_TCP1 FYVE zf-RING_UBOX
Motif
Other DBs
NCBI-GeneID: 103848812
NCBI-ProteinID: XP_009123916
Position
A1
AA seq 1721 aa AA seqDB search
MDSPDPKAPGFVDLVKSWIPRKTESSTTTTSSSHMSRDFWMPDHSCPVCYECDAQFTVFN
RRHHCRLCGRVFCAKCAANSIPSPSDEAKDSHEESSSDRRIRVCNYCYKQWEQGIVPPDK
GASIISLHFSSSPSASTTSNCTSNSSNCTVDSKTNPPASGRVSSNMDLQNASSSSHRNHS
SQDPVEFFVNSGRSDGEAYDDEDYNSDYAQSYSQGNDYYGAISLDEVDRIYGSHVAHDAG
ENIESNIQSVLPPDALNTETIDTAMQQADGWNDEKEGSPTCEEAFESEVVDFESDGLLWL
PPEPENEEDEREGLLSDDEGDEGDRGDWGYLRPSNSFKDKEFHSREKSGGAMKNVVEGHF
RALVAQLLEVDNLPMVDEGDREGWLDIITSLSWEAATLLKPDTSKSGGMDPGGYVKVKCI
PCGRRSESMVVRGVVCKKNVAHRRMTSKIEKPRLLILGGALEYQRISNQLSSFDTLLQQE
MDHLKMAVAKIHSHNPQILLVEKSVSRFAQEYLLAKDISLVLNIKRPLLERISRCTGAQI
VPSVDQLTSPKLGYCDLFHVEKFVETHFNTGQGVKKLAKTLMYFDGCPKPLGCTILLKGA
HEDELKRVKHVIQYGVFAAYHLALETSFLADEGASLPELPLQTPITVALPDKPSPINRSI
STIPGFAASSAEKSPTTELMGELHKANGDVTGNFASSKTHFQGKLDGNDRTEPSKQNTDT
DPEMITSKDNGLVPTLKSRQLSFQAEGASIQKDQWSVLPSATEQVTDGADTNEATITRDQ
SFSRHEQMDSSKGDFLPSASSDHQSILVSASTRCVWKGSVCERAHLLRIKYYGSFDKPLG
RFLRDNLFDQDRSCPSCAMPVEAHIHSYIHRQGSLTISVKKLPELLPGQREGKIWMWHRC
LKCPRISGFPPATRRIVMSDAAWGLSFGKFLELSFSNHAAASRVANCGHSLHRDCLRFYG
FGKMVACFRYASINIFAVSLPPAKLEFNCENQDWLQRESKEVINKAEVLFNEVQEALSQI
SAKTMGSIPEKIKLSLEELAGLLDQRKKEYKESLQQMLSVSKEGQPTVDILLINKLRRLI
LFDSYAWDECLTGAASMVRNNYSEALRTSSSKVMGRDFSLEKLGDEKEKSIASSNDSLPQ
DAEYDKSLKKGKSFSDISGKGVIPEDVGSDKPSESSEGGKENVVEPSQMVKAMLSESQTQ
ATTTDLSDTLDAAWIGEQTASENNGISRPPSRAASANGTQSYDLKLSDSESGLTSEEQTL
QVQMPSPSFYYSLNKNYSLNSRKHIMAEDRPVYVSSYRELEWQSGARLLLPLGINDLVLP
VYDDEPTSIIAYALTSSEYNAQMSGSDKARDRLDSGGSFSLFDSVNLLSLNSLSDLSVDM
SRSLSSADEQVSQLLQSSLYLKDLHARVSFTDESPPGKVKYSVTCYYAKEFEALRKICCP
SETDFIRSLGRCRKWGAQGGKSNVFFAKTLDDRFIIKQVTKTELESFIKFAPAYFKYLTD
SICTKSPTSLAKILGIYQVSSKHLKGGKEFKMDVLVMENLLFKRNFARLYDLKGSTRARY
NPDTSGSNTVLLDQNLVEAMPTSPIFVGSKAKRLLERAVWNDTSFLASIHVMDYSLLVGV
DEERSELVLGTIDFMRQYTWDKHLETWVKTSGLLGGPKNSTPTVISPQQYKKRFRKAMTA
YFLMVPDQWSPATVVPSNNSSSADVKDDEERDDRQGVGKNS
NT seq 5166 nt NT seq  +upstreamnt  +downstreamnt
atggactcgccagatcccaaagctcctggctttgttgatttagtcaaatcttggatccct
agaaagacagagtcctccaccaccaccacctcctcctcacacatgtctagagatttctgg
atgcctgaccacagctgtcctgtctgttacgagtgtgatgctcagttcactgttttcaac
cgaagacatcactgccgcctctgtggccgtgtcttctgcgccaaatgcgctgccaattct
atcccttctccatctgatgaagccaaggatagtcatgaggagtcgtcatcagacaggagg
atcagggtttgtaactactgctacaaacagtgggagcaagggatagttccgcctgataaa
ggagcttctattattagcctccattttagctcttccccttctgctagtaccacctcaaat
tgcacctccaacagtagcaactgcaccgttgattcaaaaacgaatcctccagctagcggt
cgtgtctcttcaaacatggatttgcagaatgcatcatcatcgtcgcataggaatcattcc
tctcaggatccagttgaattctttgtgaacagtggcaggagtgatggtgaagcttatgac
gatgaagattataactctgattacgcgcaatcttactctcaaggaaatgactactatggt
gccattagtcttgatgaagttgatcgtatctatggatcacatgtagctcatgatgctgga
gaaaacatagagtcaaacatccaaagtgtcctgccccctgacgcactgaatacagagacg
atagatacagcaatgcagcaagcagatgggtggaatgatgagaaggagggaagccctact
tgtgaagaggcctttgagtctgaagtagtagatttcgagagcgatgggctcttgtggctt
cctccggagccagagaacgaagaagatgaaagagaaggattgttatctgatgacgaaggt
gatgaaggtgatagaggtgattgggggtaccttcgcccatcgaatagctttaaagataag
gagttccactcgagggagaagtctggtggcgctatgaaaaacgttgttgaagggcacttt
agggctttggtagcacagcttttggaggttgacaatctacctatggttgacgaaggcgat
agagagggctggcttgatataatcacatctttatcatgggaagctgcaacacttctcaag
ccggatacgagtaaaagcggaggaatggatcctggtggttatgtgaaggttaaatgcatc
ccctgtggacgtcgcagtgagagtatggtggtgagaggagttgtttgcaagaaaaatgtg
gctcatcggcgaatgacttcaaagatcgagaagccacgtctgctaattcttggaggagct
ctggagtatcaacgaatatctaatcagttgtctagttttgacactttgttgcaacaggaa
atggatcatttgaagatggctgttgccaaaattcactctcacaatccccaaatcctcttg
gtggagaagtctgtctcgcggtttgcgcaggagtatcttcttgccaaggacatatctctt
gttttaaatattaaaaggccccttcttgagcgcatatcccgctgtaccggtgcgcagatt
gtcccttctgttgaccagctcacatcaccaaagctgggttactgtgacctcttccatgtg
gaaaagtttgtcgagacacattttaatactggtcaaggtgtgaagaaactggcaaagact
ttaatgtattttgatggttgccccaagcctttgggctgcacgattttgctcaagggggca
cacgaagatgaactaaaaagggtgaaacatgtgattcagtatggagtttttgcagcatat
cacttagctcttgagacatctttcttagcagatgaaggtgcttcccttccagaacttcct
ctgcagaccccaattacagtggctttacctgataaaccatcaccgattaacagatcaata
tccacaatacctggttttgctgcttcaagtgctgaaaagtctccaactactgagctgatg
ggtgagctacataaagccaatggcgacgttactggtaatttcgcttctagtaagactcat
ttccaagggaaattggatgggaacgacaggactgagccttctaagcagaacacggatact
gatccagaaatgatcacctctaaggacaatgggttagttcctactctaaaatccaggcag
ctatcatttcaggcggaaggagcttctattcagaaagaccagtggtctgttctaccctct
gccacagaacaagtcactgatggtgctgacactaatgaagccacaataacaagagatcaa
agttttagcagacatgaacagatggactcttcaaaaggagactttcttccgtcagcttct
tctgaccatcaaagcatattggtttcggcatcaacgagatgtgtgtggaagggatctgtg
tgtgaacgggctcatctactccgtattaaatattacgggagctttgacaagcctttaggc
cgattcttaagggataatctctttgatcaggatcgttcttgcccgtcatgtgcgatgcca
gtagaagcacacattcatagttatattcacaggcaaggtagtcttacaatatctgttaag
aaactgcctgaactgctacctggacaacgcgaaggaaaaatttggatgtggcatcggtgc
ctgaaatgtcctcggatcagtggctttcctcctgccacacgaagaattgtgatgtcagat
gctgcgtggggcctgtcttttggtaagtttttggaactgagcttctcgaaccatgcagca
gctagtcgtgtcgccaactgtggtcactcccttcacagagactgtctccgtttctatggt
tttgggaaaatggtggcttgcttccgctatgcttcaatcaatatatttgcagtttctttg
ccaccagcaaaacttgagttcaactgtgaaaaccaggattggctccaaagggaatctaaa
gaggtgattaataaagcggaggtccttttcaacgaggttcaggaggcacttagtcagatt
tcagcgaaaacaatgggtagcattcccgagaagataaagctttctcttgaagaacttgca
ggacttcttgatcaacgtaaaaaggaatataaggaatctttgcagcaaatgttaagcgtg
tccaaggaggggcaacctactgttgatatccttctgataaacaaacttcgaagactgata
cttttcgattcatatgcctgggatgaatgcctgacaggagcggccagtatggtgagaaat
aactattccgaagctctgaggacttcttcctcaaaagttatgggccgtgacttctcctta
gaaaagcttggtgatgaaaaagaaaagtcgattgcaagtagtaatgactctcttccccaa
gatgcggagtatgataaaagtcttaaaaagggtaaatcattttctgatattagcgggaaa
ggtgtcattcctgaagatgtaggctcagacaaaccctctgaatctagtgaaggtggtaaa
gaaaacgttgtggagccttcgcagatggttaaagcgatgctttctgagagccagacccaa
gcaacaacaacagacttatctgatactcttgatgcagcatggataggtgagcaaactgcc
tcggagaataatggtatttctcgtccccctagcagagctgcttcagcaaatggaactcag
agttatgatttaaagctgtcagattcagaaagtgggctgaccagtgaggaacagacattg
caagttcagatgccttctcctagtttttactattcactcaacaagaactattcgcttaat
tctcgcaagcatatcatggctgaagaccggcctgtttatgtttcgtcatatagagagctt
gaatggcaaagcggtgcaaggctgctacttcctctgggaatcaatgacttggtactacca
gtatacgatgacgagcctactagtatcatagcgtacgcccttacatcatcagagtataac
gctcagatgtctggatcagataaggcaagagatcggttggatagtggaggctccttttcg
ctttttgattctgtgaaccttctctcgttgaactctttgagcgatttgtcagttgacatg
agtagaagcctaagctctgctgatgaacaagtctcgcagctgctgcagtcatctttgtat
ttgaaagatctgcacgctagagtctcgtttacagatgagagtcctcctgggaaagtgaag
tactctgtgacgtgttactatgccaaggagtttgaggctctgaggaagatttgctgtccc
tcggaaactgatttcatcagatctcttggtcggtgtagaaaatggggagctcagggtggg
aagagcaatgtcttctttgcaaagactttggatgaccgttttatcatcaaacaagttaca
aagactgagcttgagtccttcatcaaatttgcgccagcttacttcaaatacctgactgat
tcaatctgtactaaaagccccacaagccttgcaaagatcttgggaatctatcaggtctca
tccaaacaccttaaaggagggaaagagttcaaaatggatgtcttggtgatggagaatctt
ctgttcaagcgtaacttcgctaggctttatgacctaaaaggctccactcgtgcccgttac
aatccggatacaagtggtagcaacacagttttgctggaccagaatctggtcgaagcaatg
cccacatctccaatatttgttgggagcaaggcaaaacggcttcttgaaagagccgtctgg
aatgatacatcgtttcttgcttcaatacacgtaatggattactcattactagtcggggta
gatgaggaacgaagtgagcttgttctaggaactatagacttcatgaggcagtacacttgg
gacaaacatttggagacttgggtcaaaacctcagggctgcttggaggaccaaagaactca
actcccacagtgatatcaccgcagcaatacaagaaacgtttcaggaaagccatgacagct
tattttctgatggttcctgaccaatggtcacctgccacggttgtgccaagcaacaacagt
tcttcagcagatgtgaaggatgatgaagagagagacgatcgtcaaggtgttggtaaaaac
tcttga

DBGET integrated database retrieval system