KEGG   Brassica rapa (field mustard): 103850551Help
Entry
103850551         CDS       T03449                                 

Definition
(RefSeq) phosphatidylinositol-3-phosphatase myotubularin-2-like
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00562  Inositol phosphate metabolism
brp01100  Metabolic pathways
brp04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103850551
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    103850551
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:brp01009]
    103850551
Enzymes [BR:brp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     103850551
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     103850551
Protein phosphatases and associated proteins [BR:brp01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    103850551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase 3-PAP LPP bPH_3 FPP PTPlike_phytase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 103850551
NCBI-ProteinID: XP_009125564
Position
A2
AA seq 828 aa AA seqDB search
MTAPRNSSRRLRSLRYSSEKMEGTGSWDVLEWTKLDQASWSSSYSNLDCLLDSERITFEC
CGVILINTNEAGTLLLTNFRILFLREGTRDPLPLGTIPLVAIEKFNKTVQKVQSNRHQST
KNPPKRLLQVTGKDMRIIVYGFPPGTKQRRSLVDALLRCSNLERVWDLYAFTCGPSKFGN
KNPKERLLNEYFRLLGKGSLRASMNMIKDGSFSVSNDCWRITDLNSNYNLCPTYPFALMV
PKSISDEELTQASTFRAKSRLPVISWCHPGTGAVIARSSQPLVGLMMNMRSNFDEKLVAS
FCTQLAGHKGAPQKLYIADARPRKNALANGAMGGGSESSSNYLQSEIVFFGIDNIHAMRE
SFSRLRDYLDMHGTTSSDGTSSFLRHGGWTWGGGNLSSMSASVSLLGESGWLSHIQSILA
GVAWIAARVAMESASVLVHCSDGWDRTTQLVSLACLLLDPYYRTFAGFQALVEKDWLAFG
HPFSDRIGMPNVAGSGSFELPIQSSSASSFPSSPVRQTSGSAATQSPGSSHGLNNYSPIF
LQWVDCVSQLMRMYPCAFEFSPTFLVDFTDCLLSCRFGNFLCNSEKERQECRITESSGCL
WAYLTDLRSFGGTSHAHCNPLYDPSRYNGALLPPAAALAPTLWPQFHLRWACPVEPDASE
TEVQCRAMSVKHLEMKKGKEEAERKVDALSSTVESLSEELRKERNISRAAKESAKRAIKE
RGVISRAVQSLGCKVNFTRSGDCTVEVEDGPQKCSHSIPHDVSESISSSVSEDKVCEALL
CPLRAREGTCRWPDAGCCAQNGSQFVGLKANFEAFEKLSIYDSYFTAE
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgccgagaaactcctctaggcgattacgatcgctgcgatattcgtcggagaag
atggaaggtaccggaagctgggacgtgcttgaatggaccaaactcgatcaagcttcttgg
tcaagctcgtactcaaacttggattgcttgctggattctgagaggatcaccttcgagtgt
tgtggagttatactcataaacaccaatgaagcagggaccctcttactcacaaatttccgt
attctgtttttgagggaaggaaccagagatcctcttccacttggtacaattccactggtg
gctattgagaagtttaacaaaacggtgcagaaagttcaatcaaacagacatcagtccacc
aagaatccaccaaaacgtcttttacaggtcactggcaaagatatgaggataattgtctat
ggttttccccctggaaccaagcagagacgttctctagttgatgcactattgaggtgtagc
aatctagagagagtatgggatctttatgcttttacatgcgggccttccaaattcggtaac
aaaaacccaaaggaaagattgcttaacgagtattttcgacttctcggaaaaggttcattg
cgagcgtcaatgaatatgattaaagacggttcattctcagtttccaatgactgttggcgg
ataactgacttgaactcgaattataacttgtgtccgacttatccatttgctttgatggtt
ccaaaatccattagtgatgaagagctgacccaagcgtctactttccgggcaaaaagtcgc
ctgcccgtgatctcgtggtgccatccaggaactggagctgtgattgctcgctcttcacaa
cctttagttggtctgatgatgaacatgaggagtaactttgatgaaaaacttgttgcttca
ttctgcactcagttagctggtcacaagggagcaccacagaagctttacatcgcagatgca
agacctaggaaaaatgcgttagcaaatggagcaatgggaggaggctcagaatcatcttca
aattatttgcaatctgaaattgtgttctttgggatagacaacatacatgcaatgagagag
agcttttcccgccttagggattatttagatatgcacggtacaacatcatccgatgggacg
tcatcattcttgagacatggtggctggacttggggtggaggtaatcttagtagtatgtct
gcttcagtatccttgcttggagaaagtggttggttgagccacatccagagcatcttagct
ggtgtggcttggattgctgcacgtgttgctatggagtcagcatcagttcttgtgcactgc
agtgatggatgggacagaacaactcagctggtttctcttgcatgcttattgcttgatcca
tactatagaacatttgctgggtttcaggctcttgtcgaaaaggattggttagcattcggt
cacccattttcagatcgtataggaatgcccaacgttgctggatctggtagttttgagcta
ccaattcaatcttcttccgctagtagtttcccttcatctccagtgcggcaaacttcagga
tcagcagctactcaatcgcctggctcttcgcatggcctgaacaactattctcctatattt
ttgcagtgggttgattgcgtttcacagctaatgcggatgtatccttgtgctttcgagttt
tctccgactttcctggtagatttcacggactgcttgctttcatgtcgttttggaaacttc
ttgtgcaacagtgaaaaggagaggcaagaatgtaggattactgaatccagcggatgccta
tgggcttacttaactgatttgcgttcctttggtggaacttctcatgcacattgcaacccg
ctttatgatccttcaagatataacggcgcattgttacctcctgctgcagctctagccccg
actctctggccccagttccaccttcgctgggcctgccctgtggaaccggatgcttcggaa
actgaggttcagtgtagagccatgtccgttaagcatttagagatgaaaaaggggaaagaa
gaagcagagaggaaggtagatgctttatcctctacggtggagtcactgagcgaagagttg
cgcaaagaaaggaatataagtcgtgcagctaaagaatcagcaaagagagctatcaaagag
cgcggtgtcatatcgagagccgtgcagtcactaggatgcaaggtgaacttcacaaggagc
ggagactgcacagttgaagtagaagacgggccgcagaaatgttctcactcaattccccat
gatgtctcggaatctatctcatcatcagtgagtgaagacaaagtttgcgaagcgttgttg
tgtccgttgcgtgccagagaaggaacttgtcgatggcctgatgcgggttgttgtgctcag
aacgggagccagtttgttgggttgaaagcaaacttcgaggcgtttgagaaactctccatc
tacgatagctacttcacagctgaatga

DBGET integrated database retrieval system