KEGG   Brassica rapa (field mustard): 103850961Help
Entry
103850961         CDS       T03449                                 

Definition
(RefSeq) caffeoylshikimate esterase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00561  Glycerolipid metabolism
brp01100  Metabolic pathways
Module
brp_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103850961
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:brp01002]
    103850961
Enzymes [BR:brp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103850961
Peptidases [BR:brp01002]
 Serine Peptidases
  Family S33
   103850961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 FSH1 Peptidase_S9 DLH
Motif
Other DBs
NCBI-GeneID: 103850961
NCBI-ProteinID: XP_009126022
Position
A2
AA seq 328 aa AA seqDB search
MGLHPVSKANASSPFGSLSAAEFYSLHSVAHSSAYITNPTGLKLFTQWWTPLHRPPLGLI
AVVHGFTGESSWFLQLTSVLFAKSGFLTCAIDHQGHGFSDGLTAHIPNINLIVGDCISFF
DDFRSRHASSSSLPSFLYSESLGGAIALYITLRQKSKWNGLILSGAMCSISHKFKPPWPL
QHLLTLAATLIPTWRVVPTRGTIAGVSFKEPWKRKLAFANPNRTVGKPRAATAYELVRVC
EDLQSRFEEVEVPLMIVHGGDDVVCDPSSVEELYMRCKSRDKTIKIYPGMWHQLIGESEE
NVDLVFGDVLKWITNRSQNDAVSNGSKA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggactccaccctgtctccaaggccaacgcttcaagccccttcggctctctctccgcc
gccgaattctactccctccattccgtcgcccactcctccgcctacatcaccaacccaacc
ggtctcaaactcttcacccaatggtggacccctctccaccgtccaccactcggcctcatc
gccgtcgtccacggcttcaccggcgagtccagctggttcctccaactaacctccgtcctc
ttcgccaagtcagggttcctcacttgcgccatcgaccaccaaggccacggcttctccgac
gggctaaccgctcacatccccaacatcaacctcatcgtcggcgactgcatctccttcttc
gacgacttccgtagccgtcacgcttcctcctcctccctaccttccttcctctactccgag
tccctcggcggcgcgatagctctctacatcaccctccgccagaaatcaaaatggaacggt
ctcatcctcagcggcgccatgtgctccatcagccacaagttcaaacccccgtggccgtta
caacacctcttaaccctagcagctactctcatccccacctggcgcgtcgtgccaactcgc
ggcaccatcgccggagtctctttcaaggagccctggaaacggaagctagcctttgctaac
cctaacagaacagtcggtaaaccacgcgccgcaacagcctacgagctagtaagagtctgc
gaggatcttcaaagcaggttcgaagaagtagaagttcccttgatgatagtacatggtgga
gacgacgtcgtttgcgatccttcctcagtcgaggagctttacatgagatgtaagagtaga
gacaagacgataaagatctatccagggatgtggcatcagctgattggtgagtctgaggag
aacgtcgacttagtgttcggtgatgttttgaaatggatcacgaaccgatcccaaaacgac
gccgttagcaatggtagcaaagcgtaa

DBGET integrated database retrieval system