KEGG   Brassica rapa (field mustard): 103851644Help
Entry
103851644         CDS       T03449                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK4 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
brp  Brassica rapa (field mustard)
Brite
KEGG Orthology (KO) [BR:brp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:brp01001]
    103851644
   01009 Protein phosphatases and associated proteins [BR:brp01009]
    103851644
Enzymes [BR:brp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103851644
Protein kinases [BR:brp01001]
 Serine/threonine kinases: Other
  Wnk family
   103851644
Protein phosphatases and associated proteins [BR:brp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103851644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103851644
NCBI-ProteinID: XP_009126757
Position
A2
AA seq 562 aa AA seqDB search
MNMNQVSEYVETDPTGRYGRFEEVLGRGAMKTVFKAIDEKLGIEVAWSQVKLKEVLRSSV
DLQRLYSEVHLLSTLNHKSIIRFYTSWIDVDSHTLNFITELFTSGTLRQYKNKYMRIDIR
AIKSWARQILEGLVYLHEHDPPVIHRDLKCDNIFVNGHLGQVKIGDLVLARMLRDCRSAH
SVLGTPEFMAPELFEGNYNELIDVYSFGMCFLEMITSEFPYSECNSPVHIYKKVSSGRLP
SAFYRVEDIEAQIFIRKCLVPASQRVSARELLQDPFLSSDESWMVYARGAGNLKPFLNEN
EMDRLKLEDDELGRTQMTITGRLKAEDNTILLEVIIADENVPGMAKKVAFPFGIMNDTSI
DVAMEMVKELEITDWDPVEIAEMIDGEISSLVPGWRYEEGDETPHVYHSSSSSQASFSNY
MTRGRQDWLQDDLHDETHSQSSYSSGSLSNLNYTYVDENSSQPPAVNRTHNVTRFRPEES
YHVRSGKANMHAASSSSNLRQASDNRTLPRNRSLADVQGQLLQRSLTEEARIRRLIRTVG
DVETVGFQPPYAVSRKPPSSRR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaatcaggtttcggagtatgtagaaaccgatccgactggtcgatatggacgt
tttgaagaagttcttggaaggggagcgatgaagacggtgttcaaagcaatcgacgagaag
cttggaattgaagtagcgtggagccaggtgaagctaaaagaggttctccgttcttctgtt
gacctacagaggctctactctgaggttcatcttctcagcactctcaaccacaaatccatt
attcgtttctacacttcctggatcgatgttgattcccatactctcaatttcatcaccgag
ttgttcacttctgggaccctccgacaatacaaaaataagtacatgcggatagatatccga
gcaatcaagtcttgggctcggcagatcttggaagggcttgtttatctccacgagcatgac
cctcctgttatccatagagacctaaagtgtgataatatctttgttaatgggcatcttgga
caagtcaagatcggcgatcttgttcttgcaagaatgctccgggactgccgctctgcccat
agtgtcctcggcactcccgagttcatggctccagaattatttgagggaaactacaacgag
ctcattgacgtttattcctttggtatgtgttttttggagatgatcacctctgagttcccg
tatagtgagtgtaacagtccggtgcacatttacaagaaagtttcttcgggaaggctacca
agcgccttttatagagttgaagacattgaggcacagattttcatcaggaaatgcctcgtg
cctgcctcacagagagtgtcagctagagaactattgcaagatccatttctgtcctctgac
gagtcatggatggtgtacgcgagaggggctgggaatctgaagcccttcttgaatgagaat
gaaatggacagactgaagttggaagatgatgagttaggaaggacccagatgaccatcact
gggaggctgaaggctgaagataacacaatcttactggaagtaataatcgcagatgaaaat
gttccaggtatggcaaagaaagtggctttcccctttggcatcatgaatgatacttccatc
gatgttgcaatggagatggtaaaagaactcgagatcacagattgggatccagtcgagatt
gctgaaatgattgatggagagatctcttctttggtgcctggttggaggtacgaggaaggt
gatgaaacccctcatgtttatcattcttcgtcatcctcccaagcttcattctctaactac
atgacacgaggccgtcaagattggctacaagatgatcttcacgatgagacgcattctcag
agttcttacagttcagggtctttgtccaacctcaactacacatatgttgatgagaacagc
tcccaacctcctgctgtgaatagaactcacaacgtaacgaggtttcgccccgaagaaagc
tatcatgtacgttctgggaaagccaacatgcatgcagcttctagttcgagtaacttgaga
caggcttcagacaaccgcacacttccaaggaaccgctcgcttgcagacgtgcagggccag
ttactgcagcggtcgctgacggaagaggctagaataagaaggttgatcagaactgttgga
gacgtggaaacagttgggtttcagccaccttacgcggtttcccggaagccaccgagttca
aggcggtag

DBGET integrated database retrieval system