KEGG   Brassica rapa (field mustard): 103851941Help
Entry
103851941         CDS       T03449                                 

Definition
(RefSeq) thiamine thiazole synthase, chloroplastic-like
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00730  Thiamine metabolism
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    103851941
Enzymes [BR:brp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     103851941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 FAD_binding_2 DAO NAD_binding_8 Pyr_redox_2 GIDA FAD_oxidored Lycopene_cycl HI0933_like RNA_pol_Rpb1_3 NAD_binding_9 Pyr_redox_3 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 103851941
NCBI-ProteinID: XP_009127069
Position
A2
AA seq 349 aa AA seqDB search
MASITSTLSLSSTKPQRLFDSYFHGSSISSAAPVSVGLKPRSLSVRATAGYDLNAFTFDP
IKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIAQSVSPG
GGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDNYVVIKHAALFTSTIMSKLLARPNVK
LFNAVAAEDLIVKGNRVGGVVTNWALVSMNHDTQSCMDPNVMEAKIVVSSCGHDGPFGAT
GVKRLKSIGLIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTF
GAMMISGQKAAHLALKALGQPNVIDGSYVGDLSPELVLAAADSAETVDA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatcacctctactctctccctctcttccaccaagcctcagcgccttttcgac
tcctatttccatggctcatccatctcctccgccgcacctgtctccgtcggtctcaaaccg
cgctccctctccgtccgcgccaccgctggctacgatctgaacgccttcacttttgacccc
atcaaggagtccatcgtgtctcgcgagatgacgaggaggtacatgactgatatgatcact
tacgccgagaccgacgtcgtcgtcgttggtgctggctccgctggactatcgtgtgcttac
gagatcagcaagaaccctaacgttcaggtcgcaatcatcgcgcaatctgtcagtcctggt
ggtggcgcgtggctcggtggtcagcttttctccgccatgattgtgcgcaaaccagctcac
ttgttccttgacgagattggtgtagcctacgatgagcaagacaactacgtcgtgatcaag
cacgctgctctcttcacatccaccatcatgagcaagcttttggctcgtcccaacgtcaag
ctcttcaacgctgtcgccgctgaggatctgatcgtgaaagggaacagagtcggcggtgtg
gtgactaactgggcccttgtgtcgatgaaccacgacacacagtcttgcatggaccctaac
gtcatggaggccaagattgttgtcagctcgtgtggtcacgatggtccctttggagccacc
ggtgtgaagaggttgaagagcattgggttgatcgaccatgttcccgggatgaaagctctt
gacatgaacacagctgaggatgcgattgtgaggttgactagggaggttgtacccggtatg
attgtgaccggtatggaagttgctgagatcgatggtgcaccaagaatgggaccaacgttc
ggagctatgatgatatcgggacagaaggcggcacacctcgctctgaaagctttgggacag
cccaatgttattgatggatcgtatgtcggagacctaagcccggagcttgtcttagcagct
gctgattcagctgaaaccgtagatgcttaa

DBGET integrated database retrieval system