KEGG   Brassica rapa (field mustard): 103852877Help
Entry
103852877         CDS       T03449                                 

Definition
(RefSeq) protein STRICTOSIDINE SYNTHASE-LIKE 12
  KO
K01757  strictosidine synthase [EC:4.3.3.2]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00901  Indole alkaloid biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    103852877
Enzymes [BR:brp01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     103852877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Str_synth SGL NHL Arylesterase
Motif
Other DBs
NCBI-GeneID: 103852877
NCBI-ProteinID: XP_009128020
Position
A2
AA seq 328 aa AA seqDB search
MMSFFSIISLLLLLFSLSSVVISDGESFRKLPVPENRSGPEAFAFDSTGKGFYTGVSGGK
ILKYTPETGYVDFAQITESSNSSWCDGVVGTALAGRCGRPAGIAFNEKTGELYVADAPLG
LHVVSPAGGLAVKIADSVDGKPFKFLDGLDVDPTTGVVYFTSFSSRYTPIQVLIALGLKD
ATGKLFKYDPSTKVVTVLMEGLSGSAGCAVSSDGSFVLVSQFTKSNIKRYWIKGPKAGSS
EDFTNSVSNPDNIKRIGSTGNFWIASVVNKIVVPTNPSAVKVNSNGEVLQTIPLKDQFGD
TLLSEVNEFDGSLYIGTLTGPFAGVLKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcatttttctccataatttctctcctgcttcttcttttctctttgtcgtcggtg
gttatctcggatggcgagtcttttcggaaacttccggtgccggaaaataggtcaggtcct
gaagctttcgcctttgactccaccggaaaaggattctacaccggagtctctggtggaaaa
atactgaagtatactcctgagacgggttatgtcgattttgcacagatcacagaatcatcg
aactcttcatggtgcgatggtgtagtcgggacggctttagccggaagatgcggtcgaccg
gcggggatagccttcaatgaaaaaacaggtgagctctacgtcgccgatgcaccgttgggt
cttcacgttgtgtctcccgccggtggcttggccgtaaaaatcgccgacagtgttgatgga
aagccctttaaatttctcgacggtcttgacgttgatccaactactggtgtcgtgtacttc
acttccttcagctcacgctataccccaattcaagtgttgattgcattgggattaaaggac
gcgaccggaaaactcttcaagtacgatccatcaacaaaggtcgtgaccgtattaatggaa
ggtttaagtggctcagctggttgtgccgtgagctcggatggttcgttcgtgcttgtcagt
cagttcacaaagagtaacatcaagaggtattggatcaagggacctaaagctggttcatct
gaagacttcacaaactcggtctcaaaccctgacaatatcaagaggattggttctacagga
aacttttggatcgcttcggttgtgaacaagatcgttgtgccgacaaacccatcagcggtc
aaagtgaactccaatggtgaagtgcttcaaacaattcctctaaaagatcaatttggggac
actttgcttagcgaagttaacgagttcgatggtagtttatacatcgggactctcactggc
ccttttgctggagttcttaagctttaa

DBGET integrated database retrieval system