KEGG   Brassica rapa (field mustard): 103853072Help
Entry
103853072         CDS       T03449                                 

Definition
(RefSeq) caffeoylshikimate esterase
Organism
brp  Brassica rapa (field mustard)
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Thioesterase FSH1 DLH
Motif
Other DBs
NCBI-GeneID: 103853072
NCBI-ProteinID: XP_009128226
Position
A2
AA seq 382 aa AA seqDB search
MDRALTSRFNIPSTLSPYYQSRTSLAAITRRFTPAIVSAKRSPIEGVSDELNLIASEELD
QAPARRRVRSAFVDLQLQLDHCLFKKAPIGIRTEEWYERNSKGEEIFCKCWLPEAGVKIK
AAVYFCHGYGSTCTFLFDGIAKQIAGSRYGVYAIDHPGFGLSDGLHGHIPSFDDLADNAI
EQFTKMKGRPELRNVPRFLFGQSMGGAIALKVHLKEPQAWDGLILVAPMCKISEDVKPPK
LVLNALILMSTLFPKAKLFPKKDMSELFFRDPSKRKLSDYDVICYDDQTRLKTAVELLNA
TRDIEMQVDKVSLPLLILHGAADRVTDPNVSKFLHEQAISEDKTLKLYPGGYHCILEGDT
DENIFTVINDIVAWLDARTTPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgctcttacttcccgttttaacattccctctactctctctccctactaccaa
agtaggacttctctggctgccatcactcgacgattcacgccggcgattgtttccgcgaag
cgatctccgatcgagggagtgagtgacgagctgaacctaatcgcctcggaggagttagat
caagctcccgcgagaagacgcgtccgttccgctttcgttgatttgcagcttcagctcgat
cactgcttgttcaagaaagctccgatcgggatcagaacagaggagtggtatgagagaaat
tcaaaaggggaggagattttctgcaagtgttggttgccggaggccggagttaaaatcaaa
gcggcggtgtatttctgtcatggttatggcagtacttgcactttcttgtttgatggcata
gcaaagcaaatagcaggttctagatatggagtgtatgctatagaccatcctggttttggc
ctctcagatggtttacatggtcacatcccaagttttgatgacttagctgataatgctatt
gaacagttcaccaaaatgaaagggagacctgaactgagaaatgtgcctcgtttcctgttc
ggacagtcaatgggaggagctattgccttgaaagttcatctaaaagaacctcaagcctgg
gatggtcttatccttgtggctccaatgtgtaagatctcagaagatgtaaagcctcctaag
ctagttttgaacgcgttgatcttgatgtcaacactgtttcccaaagcaaagctctttcca
aagaaagacatgagcgagctcttcttcagagacccgagtaaaagaaaactgtccgactat
gatgtgatatgctacgatgaccaaacgcgtctgaaaaccgctgttgagcttctgaacgcg
acaagagacattgagatgcaagttgataaagtttcattgccgttgttgatactccatgga
gctgcagatagagtgaccgatcctaatgtgagcaagttccttcacgagcaagcaatcagc
gaagataaaactctgaagctctatccaggtggctaccattgtattctagaaggtgataca
gacgaaaatattttcacagtaatcaacgacatagttgcttggctcgatgctcgtacaact
cccaagtaa

DBGET integrated database retrieval system