KEGG   Brassica rapa (field mustard): 103853260Help
Entry
103853260         CDS       T03449                                 

Definition
(RefSeq) D-glycerate 3-kinase, chloroplastic
  KO
K15918  D-glycerate 3-kinase [EC:2.7.1.31]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00260  Glycine, serine and threonine metabolism
brp00561  Glycerolipid metabolism
brp00630  Glyoxylate and dicarboxylate metabolism
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103853260
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103853260
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103853260
Enzymes [BR:brp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.31  glycerate 3-kinase
     103853260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRK SRP54 AAA_15
Motif
Other DBs
NCBI-GeneID: 103853260
NCBI-ProteinID: XP_009128426
Position
A2
AA seq 462 aa AA seqDB search
MAGATSSSLIWSPWQATLQQSTTTNNRFYLKKGYPFPCHSVYNTFSFKRRFLSSSKFNDD
HVVTASSASSKLSLLQTHFSFSAIRVVGCGCSWIQDNSMVLDSPTSYALLTSKKCPALPS
KTVDVSSVSDLFEFICSGPLVDKIGITPDNVGQSIDKWLLYGSQLCRLFQLNELMLTIPQ
KARLYHYYIPVFVWCQDQIALHTSKFKDGDDVPPLVIGFSAPQGCGKTTLVFALDYLFKT
TKMKSATISIDDFYLTAQGQAKLREENSGNALLEYRGNAGSHDLPFSVETIEALTQLTKD
GMKMKVPRYDKSAYSGRGDRADATTWPEVEGPLKVILFEGWMLGFKPLPAEAVKAVDPQL
ETVNKNLEAYYEAWDKYINAWVVIKIKDPSYVYRWRLQAEIAMRQAGKPGMSDDEVNDFV
SRYLPAYKAYLPTLYAEGPSGSDLERVLAIDIDEERNPILAT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggcaacatcatcaagtttgatatggtcgccatggcaagccactcttcagcaa
tctactactactaataatagattttatctcaaaaaaggctatccctttccttgtcactct
gtttacaatacttttagtttcaaaagacgttttctttcctcttccaaatttaacgatgac
catgtcgttaccgcttcttctgcctcctccaagctttctctgcttcagacccatttctct
ttctctgcaatacgtgttgtagggtgtggttgctcgtggattcaagacaattcaatggtt
cttgattcgcctacaagttatgcgctgctgacgtccaagaaatgcccagcattaccaagc
aaaacagtggatgtctcttcagtgtctgacctttttgagttcatttgctcgggtccactc
gtggacaagatcggcatcactcctgataatgttggtcagtccattgacaaatggttgctc
tatggctcccagctctgcagactctttcagcttaatgagcttatgctcaccattccccag
aaggccaggctttaccattactatatccccgtctttgtttggtgccaagatcagattgct
ctgcatacttccaagtttaaagatggagatgatgtgcctccacttgtgattggattcagc
gcccctcaaggatgtggcaagactacacttgtgtttgcacttgattatcttttcaaaact
accaaaatgaagtcggcaacaatatccatagacgatttttacttgactgcacaaggccag
gctaaattgagagaagagaattcaggaaatgcactcctagagtatcgtggaaatgcagga
agccatgatcttccattctctgtcgaaacaatcgaagccctgactcaactgaccaaggac
ggcatgaagatgaaagttcctcggtacgataagtctgcctacagcgggaggggtgacaga
gccgatgcaacaacatggcctgaagttgaaggacctctaaaggttattctctttgaggga
tggatgcttggttttaaacctcttcctgctgaagccgttaaagcagtggatcctcagctg
gagactgtgaacaagaaccttgaagcgtattacgaggcatgggacaagtacataaacgct
tgggtggtcatcaaaatcaaggacccaagttatgtatataggtggcgtcttcaggcggaa
atagcaatgaggcaggctggcaaaccagggatgtcagatgatgaggtgaatgattttgtg
tcgaggtatttgccggcatataaggcatatcttccgaccctgtacgcggaaggaccaagc
ggctctgacttagagcgtgtgcttgcgatagatatcgatgaagaaaggaaccccatactc
gctacctaa

DBGET integrated database retrieval system