KEGG   Brassica rapa (field mustard): 103857865Help
Entry
103857865         CDS       T03449                                 

Definition
(RefSeq) caffeoylshikimate esterase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00561  Glycerolipid metabolism
brp01100  Metabolic pathways
Module
brp_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103857865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:brp01002]
    103857865
Enzymes [BR:brp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103857865
Peptidases [BR:brp01002]
 Serine Peptidases
  Family S33
   103857865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 FSH1 Abhydrolase_2 DLH Abhydrolase_5 Esterase
Motif
Other DBs
NCBI-GeneID: 103857865
NCBI-ProteinID: XP_009133363
Position
A3
AA seq 317 aa AA seqDB search
MASETDNIMYEESFIKNTRGMKLFTCKWLPASQEPKALIFICHGYAMECSITMNSTARRL
VKAGFGVYGMDYEGHGKSDGLGAYIPNFDHLVDDVSAHYTSICEREENKGKMRFLLGESM
GGAVLLLLHRKKPEFWDGAVLVAPMCKIAEEMKPSPLVISILSKLSGVIPTWKIIPGQDI
IETAFKQPEIRKQVRENLYCYKGRPRLKTAYELLRVSTDLEKRLNEVSLPFLVLHGEDDK
VTDKAVSRELYETASSSDKTFKLYPGMWHGLLYGETPENIEIVFADIIGWLDKRASDGHG
GFESELKRENDAFQLKE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctagtgaaacagataacatcatgtatgaagagagtttcattaagaacactcgagga
atgaagctattcacgtgcaagtggttaccagcaagtcaagagccaaaggctttaatcttc
atctgccatggatatgcaatggagtgcagcatcaccatgaacagtactgcaaggaggctt
gtgaaggcaggatttggagtgtatggaatggattatgaagggcatggcaagtctgatggg
cttggcgcttatattccaaactttgaccatctcgttgatgacgtgtctgcccattacaca
tccatatgcgagagagaagagaataaagggaagatgaggtttctgctaggagaatcaatg
ggcggggcagtgcttttgttgttacacagaaagaagcctgagttttgggatggggccgtc
ttggttgctccaatgtgtaagatcgcagaagaaatgaaaccaagccctttggttatttcg
atattgtcgaagctaagcggggttatacccacatggaaaatcatccctggccaagatatt
attgagactgcttttaaacagccagaaatcaggaaacaggttagagaaaatctttactgc
tacaaaggacgtccacgtttgaagactgcttatgagctcttgagggttagcaccgatctt
gagaagagacttaatgaggtttcgttaccgttcttggtgttgcatggagaagacgacaaa
gtcacggacaaagcagtgagtagagaactttacgagactgcgtcgagttcagacaagact
ttcaagttgtaccctgggatgtggcatggtttactgtatggtgagacaccagagaacatt
gagattgtttttgctgacatcattggttggttggacaagagagcttctgatggacatgga
gggtttgaatccgagcttaaacgtgaaaatgatgctttccaattgaaagagtag

DBGET integrated database retrieval system