KEGG   Brassica rapa (field mustard): 103859746Help
Entry
103859746         CDS       T03449                                 

Definition
(RefSeq) alcohol dehydrogenase-like 5
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00010  Glycolysis / Gluconeogenesis
brp00071  Fatty acid degradation
brp00350  Tyrosine metabolism
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103859746
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103859746
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103859746
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     103859746
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     103859746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 103859746
NCBI-ProteinID: XP_009135576
Position
A1
AA seq 389 aa AA seqDB search
MDKTSSFSSHEGKPIRCKAAICRKAGEALVIEEIHVYPPQAYEVRIKIICTTLCHTDLAF
SKYNSGPVVRFPRILGHEAVGVVESIGEHVDGFKQGDVVLPVFHPHCEECRDCKSSKGNW
CTRFAEDIVSNTRRYGMASRFKDSMGEDIHHFFFVSSFSEYTVVDIAHLVKISPEIPVDR
AVLLSCGVSTGIGAAWKTADIEEGSTVAVFGLGAVGLAVGEGARLRGAAQIIGIDINPDK
FALGKEFGFTDFVNPTLCGDKKISEVIKKIAGGGVDYSFECVGITSVLSEAFISTRTGTG
KTVALGINPAAPTELHSFDLFRGKHVCGSLFGGLKPKLDIPVLVDRYLKKELNLDSFITH
ELKFEDINKAFDLLEKGKSLRCILWMDKK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacatcatcattctctagccacgaaggaaagcccattcgatgcaaagcagca
atatgtagaaaagcaggagaagcattggtgatcgaagagatccacgtttatccacctcaa
gcttacgaagttaggattaagatcatatgcacaactctttgtcacaccgatcttgctttc
tcgaaatataacagtggaccagtcgtaaggtttcctagaattctaggacacgaagcagtc
ggtgtggtcgagagcataggtgaacatgtggatggattcaaacaaggcgacgtggtattg
ccagtatttcaccctcactgtgaagaatgtagagactgcaaatcttcaaagggcaactgg
tgcacaagatttgccgaagatatcgtgtcaaacacgcgacgatacggaatggcttcgagg
ttcaaggactccatgggagaagatattcaccattttttctttgtctcaagtttttctgaa
tataccgtcgttgatatcgctcatctcgttaaaatctctcctgaaattcccgttgataga
gcggttttgctcagctgcggtgtctccacaggaattggagcagcttggaaaacggctgac
attgaagaaggctccaccgttgcagtttttggccttggtgctgttggactagcggttgga
gaaggagccaggctgcggggggcagcacaaatcatcggtattgatatcaatcctgataaa
ttcgcgttaggtaaagaatttggcttcacggatttcgtcaatcctaccttgtgtggagat
aaaaagattagcgaggtgattaaaaaaatagctggcggaggagttgactacagttttgaa
tgtgttggtataacttctgtattgagcgaggctttcattagcacccgcacgggtacagga
aaaacggtagcgttggggataaatcctgcagctccgacagaattgcatagttttgatctt
ttcagaggaaaacatgtttgtggaagtttgtttggtggtctaaaacccaagctagatatt
cccgttctcgtggatcgatacttaaagaaggagcttaatctggatagttttatcacacat
gaactgaaatttgaagacatcaacaaggctttcgacttattagagaaaggaaagtctctc
cggtgcattctgtggatggataagaaataa

DBGET integrated database retrieval system