KEGG   Brassica rapa (field mustard): 103860515Help
Entry
103860515         CDS       T03449                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-2, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00020  Citrate cycle (TCA cycle)
brp00640  Propanoate metabolism
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103860515
   00640 Propanoate metabolism
    103860515
Enzymes [BR:brp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103860515
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103860515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 103860515
NCBI-ProteinID: XP_009136375
UniProt: A0A398A389
Position
A3
AA seq 346 aa AA seqDB search
MSRQVAKLVGSLPSKLRSSVASSELLYPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRV
ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI
YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKTRLIGPNCPGIIKP
GECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVD
CLDKFFVDPQTEGIVLIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAG
AIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFELFQERGLLK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggcaagtcgcgaaacttgtcggatctctgccttccaaactccgctcttccgtg
gccagctcagagctattatacccatcatgctcgtctctcacttcgctgacaaagtctcgc
tccttcggaacaacccctccgcctcccgccgccgtcttcgtcgacaaaaacacccgcgtc
atctgccagggtattaccggaaagaacgggactttccacactgaacaagccattgaatac
ggcaccaaaatggtagcgggagtgacaccaaagaagggtggaacagagcatttgggtctt
cctgtttttaatacagttgctgaagctaaggctgagactaaagccaatgcctctgtgatc
tatgtgcccgcgccttttgctgctgctgcgatcatggaaggtgtggctgctgagttagat
cttgttgtctgtattacggaagggattccacaacatgacatggttcgtgtaaaggctgct
cttaacagtcagactaaaactaggctgattggtcctaactgccctgggattatcaaacct
ggcgaatgcaagattgggatcatgccggggtacatccacaagccggggaagatagggatt
gtttctcggtctggtacattgacatatgaagctgtttttcagactagtgcagtaggcctg
ggacagtctacgtgtgtaggaattggtggggatccttttaacggcacaaattttgttgac
tgcttggacaagttctttgttgaccctcaaacagaaggtatcgttctcattggagaaatc
ggtggtactgcagaagaagatgcagctgctttgataaaggaaagtggtacagacaagcct
gtggtggctttcattgctggactcactgcaccacctggtcgtcgaatgggtcatgctgga
gccattgtctccggtggtaagggaactgctcaagacaagataaagagcctaagagacgct
ggagttaaggtggttgagtcaccggctaagattggtgcggcaatgtttgagcttttccaa
gaaagaggtctcttgaagtag

DBGET integrated database retrieval system