KEGG   Brassica rapa (field mustard): 103861976Help
Entry
103861976         CDS       T03449                                 

Definition
(RefSeq) probable mannose-1-phosphate guanylyltransferase 3
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00051  Fructose and mannose metabolism
brp00520  Amino sugar and nucleotide sugar metabolism
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Module
brp_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
brp_M00361  Nucleotide sugar biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103861976
   00520 Amino sugar and nucleotide sugar metabolism
    103861976
Enzymes [BR:brp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     103861976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 CTP_transf_3 IspD DUF4954
Motif
Other DBs
NCBI-GeneID: 103861976
NCBI-ProteinID: XP_009137936
Position
A3
AA seq 354 aa AA seqDB search
MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV
MLNFVKEYEKKLDMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPLL
EMIQFHKNHGAEASIMVTKVEDPSKYGVVVMEKEEARVESFVEKPKHFVGDKINAGIYLL
NPSVLDRIELRRTSIEKEIFPKIASEKKLYAMVLPGFWMDIGQPKDYLTGQRMYLNYLRK
NAPGELLVTSGDGVIGNVMADETAVIGERCLIGPDVVIGAGCVIEPGVRLFGCTVMRGVR
IKEHACVSDSIVGWDSTVGSWARVADVTVLGKDVQVADAEVLQMSAKPEIIQKV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcttattctagttggaggatttggaactcgattgagaccgcttacattcagc
atgccgaaaccccttgttgattttggtaacaagcccatgattttgcatcagattgaagca
ctaaaagctgctggtgttactgaagttgtattagctatcaaccaccaacaaccagaggtc
atgttgaattttgtgaaagaatatgagaagaagcttgatatgaagatcaccttctctcaa
gaaaccgaacccctcgggacagcagggccactcgccttggctcgggacaagcttatcgac
gaatcaggcaaaccctttttcgtgctcaacagcgatgttatctgcgaatatccactcctc
gagatgatccaattccacaagaaccacggcgctgaagcttccatcatggtgaccaaagta
gaagatccttcaaagtacggtgtggtggttatggagaaagaagaagcaagagtcgaaagt
ttcgtcgagaaaccaaaacattttgtcggggacaagatcaacgctgggatatacctcttg
aacccgtctgtgctcgacaggatcgagctcagacggacgtcgatagagaaagagatattc
cccaagatcgcttcggagaagaagctttacgccatggtgctaccaggtttctggatggac
attggtcagccgaaagattatttgacagggcagagaatgtacctcaactatctgagaaag
aatgcgcctggggagcttttagtgacgtcgggagatggagtgatcgggaacgttatggcg
gatgagaccgcggtgataggggagcgatgcttgataggacctgacgtggtgattggtgca
ggatgcgtgattgaacctggtgtgaggttgtttggttgcactgtgatgagaggtgtgagg
atcaaggagcatgcttgtgtgtctgatagtatcgtggggtgggactcgaccgttggaagt
tgggctcgtgttgctgacgtgacggttctcgggaaagatgttcaggttgcggatgcagag
gttttacaaatgtctgcgaaaccagagatcatacagaaagtatga

DBGET integrated database retrieval system