KEGG   Brassica rapa (field mustard): 103862090Help
Entry
103862090         CDS       T03449                                 

Definition
(RefSeq) putative glutathione peroxidase 7, chloroplastic
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00480  Glutathione metabolism
brp00590  Arachidonic acid metabolism
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103862090
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103862090
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103862090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 103862090
NCBI-ProteinID: XP_009138047
UniProt: A0A397KY39
Position
A3
AA seq 232 aa AA seqDB search
MASSSYAPFSAVFSGFAATKPNPPPTCSAFLVPKRRSNSRNLKNGVSLKSWNKHGFQFTS
RNLSVYARATEEKTVHDFTVKDISGKDVSLDKFKGKPLLIVNVASKCGLTSSNYTELSQL
YDKYRNQGFEILAFPCNQFGGQEPESNPDIKRFVCTRFKAEFPIFDKVDVNGPSTAPIYQ
FLKSKSGGFLGDLIKWNFEKFLVDKKGNVVQRYPPTTSPLQIEKDIQKLLVA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcctcttacgcaccattctctgcagtcttcagcggtttcgctgcaacgaaa
cctaacccacctccaacttgttctgcttttctcgtccctaagcgaagatcaaattctcgg
aatctgaaaaatggggtttccttgaaatcttggaataagcatggatttcaattcacatca
agaaatttgagtgtgtatgcaagagctactgaagagaagactgttcatgatttcactgta
aaggacataagtgggaaggatgtttccctagacaaattcaaaggaaaacctctgttgatc
gttaacgttgcttcaaaatgtggtttaacatcatcaaactacacagagctttcacaattg
tacgacaaatacagaaaccaaggatttgagattctagctttcccttgcaatcaatttgga
ggtcaagaacctgaatcaaacccggatatcaagcggttcgtgtgtaccagatttaaagct
gagttccctatattcgataaggttgatgtgaatggaccgagcacagctccaatctaccag
ttcttgaaatcaaagtcgggtgggttcttgggtgatctcatcaagtggaactttgagaaa
ttcttggttgacaaaaaaggcaacgtcgtccagagataccctcccacgacttctccttta
caaattgagaaagacatccagaagttgcttgtggcttaa

DBGET integrated database retrieval system