KEGG   Brassica rapa (field mustard): 103863401Help
Entry
103863401         CDS       T03449                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00520  Amino sugar and nucleotide sugar metabolism
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103863401
Enzymes [BR:brp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     103863401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 103863401
NCBI-ProteinID: XP_009139397
Position
A4
AA seq 432 aa AA seqDB search
MKQLHKQMSSKRDDDTIPMSQSSPYSPKALKHPRSLPRSLHYLFREQRLLFILVGILIGS
TFFILQPSLSRLAPAESTSLITRSVVDSNNYSPSKMSFNYGGGRTGRVPVGIGGRRLRIV
VTGGAGFVGSHLVDKLIGRGDEVIVIDNFFTGRKENLVHLFSNPRFELIRHDVVEPILLE
VDQIYHLACPASPVHYKFNPVKTIKTNVMGTLNMLGLAKRVGARFLLTSTSEVYGDPLEH
PQKETYWGNVNPIGERSCYDEGKRTAETLAMDYHRGAGVEVRIARIFNTYGPRMCLDDGR
VVSNFVAQAIRKNPMTVYGDGKQTRSFQYVSDLVDGLVALMEHDHVGPFNLGNPGEFTML
ELAEVVKEVIDPSATIEFKPNTADDPHKRKPDISKAKELLNWEPKISLRDGLPRMVSDFR
NRILNEDEGKGL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcttcacaagcaaatgagctcgaagcgcgacgacgacacaatccccatgagc
cagtcgtctccttactcacccaaggccttaaagcaccccagatctctccccagatcgctc
cactacctcttccgcgaacagaggctcctcttcatcctcgtcgggatcctgatcggatca
accttcttcatcctccagccttctctctcccgcttagcccccgccgagtccacctccctc
atcaccagatccgtcgtcgacagtaacaactactcgccttccaagatgagtttcaattac
ggcggaggtagaacaggtcgtgttcccgtcggtatcggagggcggaggctgaggatcgtg
gtgacaggtggagctggattcgtcgggagccatctcgtggataagcttatagggagggga
gatgaggtgatcgtgattgataacttcttcacggggaggaaggagaatttggttcatctg
ttctcgaatccgaggtttgagctcattcgtcacgatgtggtggagccgattctcctcgag
gttgatcagatttaccatctagcttgcccagcttcacctgttcattacaagtttaatcca
gtcaagactatcaagacaaacgtaatgggaactctcaatatgttgggtctggcaaagaga
gttggagcaaggtttctgctcactagcacaagtgaagtctatggagatcctcttgagcat
ccacagaaggagacgtattggggaaatgtgaacccaatcggtgagaggagttgctatgat
gaaggaaagcgtactgcagaaacactggccatggattatcaccgaggtgctggtgtggag
gtaaggattgctcgtattttcaacacgtatggaccgcgaatgtgcctcgatgatgggcgt
gttgttagtaacttcgttgcccaggccatccgcaaaaacccaatgactgtttatggtgat
ggaaaacaaactcgaagctttcaatatgtttctgacttagtggatggacttgtagcgtta
atggaacacgatcacgtaggacctttcaatcttggtaacccaggagaattcacaatgctt
gagcttgcagaggtggttaaggaggtgattgacccgagtgcgaccatagagttcaaacca
aacacagcggacgatcctcacaagaggaaaccagacataagcaaggcgaaggagcttctg
aactgggaaccaaagatctctctgcgtgatggtctccctcgtatggtcagtgacttccgt
aaccgaatcttgaacgaagatgaaggcaaaggtctctaa

DBGET integrated database retrieval system