KEGG   Brassica rapa (field mustard): 103863902Help
Entry
103863902         CDS       T03449                                 

Definition
(RefSeq) uncharacterized protein LOC103863902
  KO
K17434  large subunit ribosomal protein L53
Organism
brp  Brassica rapa (field mustard)
Brite
KEGG Orthology (KO) [BR:brp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:brp03011]
    103863902
Ribosome [BR:brp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    103863902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 103863902
NCBI-ProteinID: XP_009139907
UniProt: A0A397ZT01
Position
A4
AA seq 128 aa AA seqDB search
MLKFLSKVKIEFNTLDPRLASCVEFLAQCNARKAKESNPNCQVLVKRRTDDQPPQISVTF
VNGVEEAFDAAATSAQSIRKMILDKGQYLETEQMFREAGEQWPVIIPEEEIHQEAPGVKP
RKAEDKKQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagttcctatcaaaagtaaagatcgagttcaacacattggacccaagactcgcc
tcctgcgtcgagttcttggctcagtgcaacgcgaggaaggccaaagagtccaaccctaac
tgtcaggttctggtgaaacgcagaaccgacgatcagccaccgcagatcagtgtcactttc
gtcaatggtgtcgaggaagctttcgatgcggctgccacgtcggctcagtcgatcaggaag
atgattcttgataaagggcagtatctcgagacggagcagatgttccgtgaagccggggag
cagtggcctgtcatcatccctgaggaggagattcaccaagaagctcctggtgttaagccg
aggaaagcagaagacaagaagcaatga

DBGET integrated database retrieval system