KEGG   Brassica rapa (field mustard): 103866802Help
Entry
103866802         CDS       T03449                                 

Definition
(RefSeq) beta-glucosidase 29 isoform X1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00460  Cyanoamino acid metabolism
brp00500  Starch and sucrose metabolism
brp00940  Phenylpropanoid biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103866802
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    103866802
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    103866802
Enzymes [BR:brp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     103866802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 MJ1316
Motif
Other DBs
NCBI-GeneID: 103866802
NCBI-ProteinID: XP_009143033
UniProt: A0A397Z6J1
Position
A5
AA seq 583 aa AA seqDB search
MKLPFLILLLIATWFTKNVISPSPESRLLDRSDFPDDFIFGTATSAFQTEGATSEGGKSP
TIWDYFSHTFPERTNMQNADVAVDFYHRYKDDIKLLKELNMDSFRFSISWARLIPSGKVE
DGVNKEGLQFYNALIDELLAHGIRPSVTLYHWDHPQALEDEYGGFLSPQIIEDFRNFARV
CFENFGDKVKLWTTINEPSVISIAGYDTGNKAVGRCSKWVNNKCQAGDSATEPYIVSHHL
LLSHAAAVQEFRKCNKTSKDGKIGIVISPPWLEPYDFTSSADKHAVERGLTVEIDWHLDP
VVYGDYPKIMKKHAGSRLPSFTAEQSKMLRNSYDFIGINYYTARFVAHRPHIDPALRRFR
TDHQFERKEKNHSNHLIGPGENRGVLYYSYPEGFRRLLNYVKDKYNNPIVYIKENGINDY
DDGTKSRDEILNDTFRISYHTDHLQQLHKAIIDDGCDVRGYYTWSLLDNFEWEHGYSTRF
GLYYIDRENDLKRYPKDSVHWFKQFLNIPVLKGEQTENEEGWKEENNNKTLDDSEGFETS
IDSIINLMTNTSRIEEEGKDICAFENPNDQLGFLLGPQSYLEL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccttttctcattctccttctgatagcgacgtggtttacaaaaaacgttatt
tctccttctcctgaatctcgactacttgatagaagtgattttccagatgatttcattttt
ggaactgcaacgtcggcctttcagaccgaaggtgcaactagtgaaggtgggaaatcccca
actatttgggattacttcagccacacttttccagaaagaacaaatatgcagaatgcagat
gtggcagtcgatttttatcatcgttataaggatgacatcaaattgctgaaagagctaaat
atggactctttcagattttcaatttcgtgggctaggttaatacccagtggaaaggtagag
gatggagtaaataaagaaggtttacagttctataacgctctcatcgacgaacttcttgct
catgggattcgaccttcggtgactctctatcactgggaccatcctcaagctctcgaggac
gagtatggtggtttcttaagccctcaaataatagaagattttcgaaattttgcaagagtt
tgttttgaaaacttcggagataaagttaagttgtggacaactataaatgaaccatccgtt
ataagtattgcggggtatgacacgggcaacaaagcagttggaaggtgctcgaaatgggtg
aataataagtgtcaagccggtgactcggcaaccgagccttacattgtatcacatcatctt
cttctttctcatgcagcggcagtacaagagttccgaaaatgtaacaagacttcaaaagat
ggtaagattgggattgtgatatcgcctccgtggcttgaaccttacgacttcacttcatct
gccgacaaacatgctgttgaacgaggccttaccgtagaaatagattggcatctagatccg
gtagtttacggcgattatccaaaaatcatgaaaaaacacgccggtagtagattaccttct
ttcacagcagaacagtcaaagatgttaagaaattcatatgacttcattggaataaactat
tacactgcacgcttcgtcgctcatcgtcctcacattgaccctgcactgcgtcgatttagg
actgatcatcaatttgagaggaaagaaaaaaatcatagtaaccacctaattggaccaggg
gaaaatcgaggcgtactctactactcgtacccagaaggttttcgaagacttctaaactac
gttaaagataaatacaataatcctatcgtctatataaaagagaacggaatcaatgactac
gatgatggtacaaaatcacgagatgagattctcaacgatacatttaggataagctatcat
acggaccaccttcaacaactccataaagctataatagatgatggatgtgacgtcagagga
tattacacgtggtcgttactggacaactttgaatgggagcatggatactctactagattc
ggtctttactacattgaccgcgaaaacgatcttaaacggtatcctaaagattccgtccac
tggttcaaacagtttctcaatataccggtgctaaaaggtgaacaaacagagaatgaagaa
ggttggaaggaagaaaataataacaagactttggatgattcagaaggttttgagacatcg
attgattctattataaatctcatgacaaacacatcgagaatagaagaagagggaaaagat
atctgcgcttttgagaatcctaatgatcagctcggtttcttgttggggccgcaaagttat
ttggaactctag

DBGET integrated database retrieval system