KEGG   Brassica rapa (field mustard): 103867132Help
Entry
103867132         CDS       T03449                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00601  Glycosphingolipid biosynthesis - lacto and neolacto series
brp00603  Glycosphingolipid biosynthesis - globo and isoglobo series
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103867132
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    103867132
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:brp01003]
    103867132
Enzymes [BR:brp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     103867132
Glycosyltransferases [BR:brp01003]
 Glycan extension
  P blood group
   103867132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug TcdA_TcdB Caps_synth DnaA_N
Motif
Other DBs
NCBI-GeneID: 103867132
NCBI-ProteinID: XP_009143417
Position
A5
AA seq 396 aa AA seqDB search
MEKDNSNKKSLSEQLKHTNSPVFSTAIFSFIMLLVVVGTMLSNMSLESTFFWTSPTSEVI
TMERKPLAPPKNSTSRYRISWLRSHLKEFEVFKSTNLSEKFHQRVLESLNDECEVRFFMT
WFSPADYFGKREFLAVESVFKSHPQGCLMIVSGSMDSPQGSTILKPISDLGYKVFAATPD
VSSLLENTPAKTWFQEMKSCKRDPGRIPLSQNLSNLARLAILYKYGGVYLDTDFIVTRSF
KGLKNSIGAQTVVEGDSKNWTRLNNAVLVFEKEHPLVYSFMEEFASTFDGNRWGNNGPYL
VTRVVQRAQETIGNSFTVLQPVAFYPFNWIDIQRLFQTPRSRNDSTLLKADLIKLNQESY
GLHLWNKITKKLKIEKGSAIDIIISEHCVVCKGIQR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggataacagcaacaagaagagtctctctgaacaactcaagcacacgaattcc
ccggtgttctccaccgccattttctccttcataatgctgcttgttgtggtgggaacaatg
ctctcaaacatgtctctagagtcaactttcttctggacttcaccgacctctgaggtaatc
acaatggagagaaagccactggctcctcctaagaacagcacaagcagatacagaatctct
tggcttcgttctcatctcaaagaattcgaggttttcaagtcaaccaacctttcagagaag
tttcaccaaagggttcttgagtctttaaatgatgaatgtgaggttagattcttcatgaca
tggttttcaccagcagattatttcggcaagagagaatttctagctgtagaaagcgtcttt
aaatctcatcctcaaggctgcttgatgatcgtttcaggatccatggactctccacaagga
agtaccatccttaaaccaataagtgatcttggttacaaggtgtttgcagccacaccagac
gtctcatcccttcttgagaacacaccggccaaaacttggtttcaagaaatgaaaagctgc
aaaagagatccagggaggataccgttatctcagaacctttcaaacctcgcgaggctagcg
attctatacaagtacggaggcgtgtacctggacacggacttcatcgtcactagaagcttt
aaagggttgaagaactcaataggagcgcaaacagttgtggaaggagattcaaagaactgg
acaaggctgaacaatgcggttcttgtctttgagaaagaacaccctcttgtttacagcttc
atggaggagtttgcttccacttttgatgggaacagatggggaaacaatggtccttacttg
gtgacaagagtagtgcagagagcacaagagactatagggaacagtttcacagtattgcaa
ccagtagcgttctatccatttaattggatagacattcaaagattgtttcagacgccaagg
agtagaaatgactcaacattactcaaagccgatctgatcaagctgaaccaggaaagctat
ggactgcatctgtggaacaagattactaaaaagcttaagatcgaaaaaggcagtgctata
gacatcataatttcagaacattgtgttgtttgcaaaggaatccaaagatga

DBGET integrated database retrieval system