KEGG   Brassica rapa (field mustard): 103870025Help
Entry
103870025         CDS       T03449                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED3, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00906  Carotenoid biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Module
brp_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    103870025
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     103870025
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65 KI67R
Motif
Other DBs
NCBI-GeneID: 103870025
NCBI-ProteinID: XP_009146365
Position
A5
AA seq 597 aa AA seqDB search
MTSFTATTAVSRRLVGGNHTKPPLSSSQSSALSYSCSVPMTNRSQRKLNVSSALHTHPAL
HFPKQSSTSPAIIVNPKTKESDTKQMNLFQRAAAAALDAAEGFLVSHERQHPLPKTADPS
VQIAGNFAPVNEQPLRRNLPVVGKIPDSIKGVYVRNGANPLHEPVTGHHFFDGDGMVHAV
KFEDGSASYACRFTQTNRFIQERQLGRPVFPKAIGELHGHTGIARLMLFYARAAAGLVDP
AHGTGVANAGLVYFNNRLLAMSEDDLPYQVRITPGGDLKTVGRYDFDGQLESTMIAHPKV
DPESGELFALSYDVVSKPYLKYFRFSPDGEKSPDVEIQLDQPTMMHDFAITENFVVIPDQ
QVVFKLQEMIRGGSPVIYDKEKVARFGILDKYAADSSGIRWIEAPDCFCFHLWNAWEEPE
TEEVVVIGSCMTPPDSIFNESDENLKSVLCEIRLNLRTGESTRRPIISDGDQQVNLEAGM
VNRNMLGRKTKFAYLALAEPWPKVSGFAKVDLATGEVKKHLYGDDRYGGEPLFLPGEGAE
DDGHILCFVHDEMTWTSELQIVNAVSLEVEATVKLPSRVPYGFHGTFIGASDLANQV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgacttctttcacggcgactacggcggtttctcggagattggtcggtggtaatcatact
aaaccaccattatcgtcttctcaaagctccgccttgagttattcttgctccgtacccatg
acaaatcgttcccaacgaaagctcaatgtttcttctgcgcttcacactcatcctgctctc
catttccccaagcaatcctccacctctcccgccattattgtcaacccaaaaaccaaagaa
tctgacaccaaacagatgaacttgttccagagagcggcggcggcggcgctggacgcggcg
gagggtttcctcgtgagccacgagcgacagcatcccctccccaaaaccgccgatcctagc
gttcaaatcgccggaaacttcgctccggtgaacgaacagcctctccggcgtaacctcccg
gtggtcggaaaaataccggattccatcaaaggagtgtacgtgcgcaacggagccaacccg
cttcacgagccggtgacaggtcaccacttcttcgacggagacgggatggttcacgccgtg
aaattcgaagacggttcagctagctacgcttgccggtttactcagaccaaccggtttatc
caggaacgtcaactgggtcgaccggttttccccaaggccatcggcgagcttcacggccac
accggtattgctcgactcatgctattctacgccagagccgcagccggtttagtcgacccg
gctcacggaaccggagtagctaacgccggtttagtctatttcaataaccggttattagcc
atgtcggaagacgatttgccataccaagtccggatcactccaggtggagacttgaaaacc
gttggccgttacgatttcgacgggcagttagaatccacaatgatcgcccacccgaaagtc
gacccggaatccggcgagctattcgctctaagctacgacgtcgtttcaaagccttactta
aaatacttccgcttctcaccggacggagaaaaatcgccggacgtcgagatccagctcgat
cagccgacgatgatgcacgacttcgcgataacagagaacttcgtcgttataccggaccag
caagtcgtcttcaagctccaggagatgatccgcggcggctctccggtgatctacgacaag
gagaaggtcgcgagattcggaattttagacaaatacgcggcggactcgtcgggaatcagg
tggatcgaagctccggactgcttctgcttccacctctggaacgcgtgggaggagccggaa
acagaggaggtcgtcgtgatcgggtcgtgcatgactccgccggactcaattttcaacgag
tccgacgagaatctcaagagcgtcctctgcgagattcggctcaacctcagaaccggagag
tccactcgccgtccgatcatctccgacggagatcaacaagtcaacctcgaagcagggatg
gtgaaccggaacatgctcggccgtaagacaaagttcgcttacctcgctttagccgagccg
tggcctaaagtctccggttttgcgaaagtcgatctcgccaccggagaagtcaagaagcat
ctctacggcgatgaccgttacggtggagagcctctgtttctccccggagagggagcagaa
gacgatgggcacatcctctgttttgttcacgacgagatgacgtggacgtcagagttacag
atagttaacgccgttagcttggaggttgaagcgacggttaaacttccgtcaagggttccg
tacgggtttcacggcacatttattggagccagtgacttggcgaatcaggtgtaa

DBGET integrated database retrieval system