KEGG   Brassica rapa (field mustard): 103870081Help
Entry
103870081         CDS       T03449                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00010  Glycolysis / Gluconeogenesis
brp00020  Citrate cycle (TCA cycle)
brp00620  Pyruvate metabolism
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
brp01200  Carbon metabolism
Module
brp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103870081
   00020 Citrate cycle (TCA cycle)
    103870081
   00620 Pyruvate metabolism
    103870081
Enzymes [BR:brp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     103870081
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding CCDC71L Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 103870081
NCBI-ProteinID: XP_009146432
UniProt: A0A397ZFM8
Position
A5
AA seq 537 aa AA seqDB search
MVYASRIISHSKKLKHVSTLLRREHAVAVRGFSNTTQPSLTGREDMLKTRLNYSPAERIS
KCSASNVPIPSGISAMRTKPMTGPTFFREYISSQMRSVRGFSSSSDLPPHQEIGMPSLSP
TMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGYLAKIVKEEGAKEIQVGE
VIAITVEEEEDIQKFKDYTPSSGTPPAPEEKPAPSPPKEEKVEKPASAPEAKTSKPSSAP
SEDRIFASPLAKKLAEDSNVPLSSIKGTGPEGRIVKADVEEFLASRGKETTAKPSKPTDS
KVPALDYVDIPHTQIRKVTASRLAFSKQTIPHYYLTVDTCVDKLMGLRSQLNSFQEASGG
KRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFSNVNINVAVQTENGLYVPVVKDADK
KGLSKIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNLGGPFGIKQFCAVINPPQAAILAI
GSAEKRVVAGSGPDQFNVASYMSVTLSCDHRVIDGAIGAEWLKAFKGYIETPESMLL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggtttacgcatcccgcatcatcagccattccaagaagctgaaacatgtttccacttta
ctacgacgtgagcatgctgtggcagtccgcggtttctccaacactacccagccctctctc
actggaagagaagatatgctcaagactcgcctgaattattccccggcagagaggatttcg
aaatgtagtgccagcaatgtgccaattcctagtggtatttcagctatgcgcacaaaacca
atgacaggaccaaccttttttagagaatatataagctcccagatgcgatcagtaagagga
ttttcatccagctcagatcttcctcctcatcaagagatcggaatgccttctctctcccca
acaatgactgagggtaacattgccaggtggctgaagaaagaaggtgataaagttgctcct
ggtgaagtgctttgtgaagttgaaactgacaaagcaaccgtcgaaatggaatgcatggaa
gaaggttatctcgccaagatagtgaaggaggaaggagcaaaagaaattcaagttggtgag
gtgattgctatcacagttgaagaagaagaagatattcaaaagttcaaagattacaccccc
tcatctggtactcctcccgctcctgaagaaaaaccagctccttccccaccaaaggaagag
aaggtcgagaagccagccagtgcacctgaagccaagacatccaagccaagctcggctcct
tcagaagatcgtatttttgctagtcctcttgccaaaaagttggctgaagatagtaatgta
cctctctcaagcatcaaaggcacaggtcctgaaggacgaatagtgaaggctgatgtcgaa
gagttcttagcttcacgcggtaaagaaactactgccaagccttccaagcccaccgattcg
aaggttccagctttggactacgttgatatccctcacactcagatccgaaaggtcacagcc
tcacgtttggcattctcaaagcaaactattccccactactacttgaccgtggacacatgt
gttgacaaactgatgggccttaggagccaattgaattcatttcaagaggcgtccggcggg
aaacggatatcagttaacgaccttgttattaaggctgctgcattggctctaaggaaagtt
cctcagtgtaatagttcatggactgacgaatacatccgccaatttagcaatgtgaacatc
aacgtggcagtacaaacagaaaatggtctttacgttcctgttgtcaaggacgcggacaag
aaagggctgtctaaaattggagaagaggttagattcttggctcaaaaagctaaagaaaac
agcttgaagcctgaagattatgagggaggaacattcacagtctccaacttgggaggacct
tttggcattaaacagttctgcgcagtcatcaatccacctcaagccgctattctagcaatc
ggatcagctgaaaagagagttgttgctggtagcggccctgaccagtttaacgtggcttcg
tacatgtctgtaacacttagctgtgatcaccgcgtaatagatggtgcgattggagctgaa
tggttgaaagcattcaagggttacatcgagaccccagaatctatgttgctctaa

DBGET integrated database retrieval system