KEGG   Brassica rapa (field mustard): 103871767Help
Entry
103871767         CDS       T03449                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00010  Glycolysis / Gluconeogenesis
brp00562  Inositol phosphate metabolism
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103871767
   00562 Inositol phosphate metabolism
    103871767
Enzymes [BR:brp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103871767
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103871767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103871767
NCBI-ProteinID: XP_009148300
UniProt: A0A397Z275
Position
A6
AA seq 483 aa AA seqDB search
MAMKTVWLIILVCCFFVVSQADQAFDVRHHLSTVTRYSVSKDVTQNLIEGSNVPSECTPI
HLNLVARHGTRSPTKKRLRELENLAGRLKELVRNLPSDKVPGWLGKWVSPWKGKVKGGEL
IRQGEEELYQLGIRVRERFPTLFEEDYHPDVYTIRATQIPRASASAVAFGMGLFSEKGDL
GPGRNRAFAVTSENRASDTKLRFFECCQNYKSYRKAKEPAVDKLKEPVLNKITASVVKRH
GLSFTKQDVSSLWFLCKQEASLLNVTNQSCELFTPSEVALLEWADDLEVFILKGYGNSLN
YKMGVPLLEDVLHSMEEAIKAREENLPAGSYEKARLRFAHAETIVPFSCLLGLFLDASEF
EKIQKEKPLELPPQPPKTRDFKGSTMAPFGGNNMLVLYSCPAASSPKYFVQVLHNEHPIA
VPGCDGKDFCPLEDFKAKVVTPHLKHAFNNLCNANLDDPKQNHPSGKLSFWSWLVGSSQK
TEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaagacagtttggctgatcattctggtgtgttgtttcttcgttgtttcacag
gcagatcaagcttttgatgttcgtcaccacttatccactgtcaccagatactctgtttca
aaagatgtcacacaaaatttgattgaagggtcaaatgtccctagtgagtgtacacctatc
cacctcaaccttgtggctaggcatgggactcgttctcctactaagaaaaggttgagggaa
ctggagaatttagctggtaggttaaaggaacttgtaaggaacttgccttcagataaagtt
cctggatggttagggaagtgggtttctccttggaaggggaaagtgaaaggcggggagctg
atcaggcaaggcgaggaggagttgtaccagcttggaatcagggttagggaacggttccct
actttgttcgaagaggattatcaccctgatgtctataccataagagctacgcagattcct
cgggcgtctgcaagtgcggtggcgtttggaatggggttgttcagtgagaaaggagacttg
ggaccggggcgtaatagagcgtttgctgtcactagtgagaaccgtgctagtgataccaag
ctgaggttttttgagtgttgtcaaaactacaagagctatagaaaagctaaagagcctgct
gtggataagctcaaggaacctgttctgaataagattacagcttccgttgttaagagacat
ggtttgagtttcaccaaacaggacgtttcttctctctggtttctgtgcaagcaggaagct
tcattgcttaatgtaactaatcaaagctgtgaacttttcactccatctgaggttgctttg
ctggaatgggcagatgacttggaagtgtttattctcaaaggttatggaaattcattgaac
tacaaaatgggagttccattgctcgaagatgttttgcattccatggaagaagctatcaag
gcccgtgaagaaaatctcccagctggaagttacgagaaagcaagacttaggtttgcacat
gccgaaacaatagtccccttctcttgtcttcttggacttttccttgatgcatctgagttt
gagaaaatacagaaggagaaaccattggaactccctcctcagcctcctaaaaccagggac
tttaaaggcagcaccatggctcctttcggtgggaacaacatgcttgtcctctacagttgt
cctgcagcttcctcgcctaagtacttcgtccaggttctgcacaacgagcatcctattgca
gttccaggttgtgatggaaaagacttctgtcctcttgaagatttcaaggccaaagtggtg
acccctcatctcaagcatgcttttaacaacctttgcaatgctaatctagatgaccctaaa
cagaaccatccatcaggtaagttatctttttggagctggctggttgggtcgagccaaaaa
accgagctctaa

DBGET integrated database retrieval system