KEGG   Brassica rapa (field mustard): 103871807Help
Entry
103871807         CDS       T03449                                 

Definition
(RefSeq) glutathione S-transferase U17
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00480  Glutathione metabolism
brp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103871807
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brp02000]
    103871807
Enzymes [BR:brp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103871807
Transporters [BR:brp02000]
 Other transporters
  Pores ion channels [TC:1]
   103871807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 103871807
NCBI-ProteinID: XP_009148363
UniProt: A0A397YVP9
Position
A6
AA seq 227 aa AA seqDB search
MASDEVKVIGAWASPFVMRPRIALNLKSVPYEFLQESFGAKSELLLKSNPVHKKIPVLIH
ADKPVCESNIIVEYVDETWSASGPSMLPSTPYDRAIARFWAAYIDEKWFPSLKSILKAEG
EEEKKAVLAQVEEGNALLEKAFNDCSKGKPFFNGDHIGYLDIAFGCFLAWLRVTELAGGH
KLIDEVKTPSLSKWAERFCNDPAVKPVMPETATLAEFAKKIFAKPPA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgacgaagtgaaggtgatcggcgcatgggcgagtccttttgtgatgaggccg
aggattgctctaaacctcaagtcggttccctacgagttcctccaggagtcgtttggagca
aagagcgagttgcttcttaaatcaaacccggttcacaagaagattcccgtcctgattcat
gctgacaaaccggtttgtgagtctaacatcatcgttgagtatgttgatgagacttggagc
gcatctggaccgtccatgctaccttccactccttatgatcgagccatcgctcggttctgg
gcggcctacattgatgaaaagtggtttccctctctaaaaagtatcctaaaagctgaggga
gaagaagagaagaaggctgtgttagctcaagtggaagaagggaacgcgcttctcgagaag
gccttcaacgattgcagcaaaggaaaaccattcttcaatggtgatcacatcggttacctc
gacattgcgtttgggtgcttcttggcttggttgagagtcaccgagttggcaggtggtcat
aaacttattgatgaggtcaagactccttctctgtccaaatgggctgagaggttctgtaac
gatcctgctgtgaaacctgtcatgcccgagactgcaacgcttgctgaattcgccaagaag
atctttgccaagccgccggcctaa

DBGET integrated database retrieval system