KEGG   Brassica rapa (field mustard): 103872154
Entry
103872154         CDS       T03449                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00100  Steroid biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Module
brp_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103872154
Enzymes [BR:brp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103872154
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 103872154
NCBI-ProteinID: XP_009148752
Position
A4
AA seq 365 aa
MDPRLLIPSSQSVCVLVFYFVYLAVAGEILPGKVIRGVVLSDGSQLRYRCNGLFALSLLV
AILGISAKLGVLSPLVVADRGLELLSATFIFCVLVTLVLYITGRSSSDKSSSLKPHVSGY
LVHDWWFGIQLNPQFIGIDLKFFFVRAGMMGWLLINLSILAKCVQDGSLSQSMILYQIFC
ALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSIQGWWLLHNKVELTVPGI
VANCFVFLIEYMVFRGANKQKHIFKKNPKTPIWGKPPVVVGGKLLASGYWGIARHCNYLG
DLMLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEERCAEKYKEIWPKYLRLVPYRI
LPYVY
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggatccccgtcttctcattccctcatcgcaatccgtttgcgtgctggtgttttacttc
gtctacttagccgtcgccggagaaatcctccccggaaaagtgatccgcggcgtcgtttta
tcagatggctctcagcttcggtaccgatgcaatggtctattcgcactgtcattgctggtt
gctattttgggaatctctgcaaaactcggcgttttgtcacctcttgtggttgctgataga
ggacttgagttactctcagctacttttatcttctgtgttttggtgacactggtattgtac
attactgggcgcagttcttccgataagagttcttccctaaaacctcacgtctcaggatat
cttgtacacgactggtggtttggaatacagctgaatcctcagtttattggcattgatctc
aagtttttctttgtcagagccgggatgatgggatggctgcttatcaatctctctattctg
gcaaaatgtgtccaggatggttctttgagtcagtccatgattctttaccagattttctgt
gcgttatatatattggactactttgttcatgaagaatatatgacctccacgtgggacata
attgcagagaggttgggctttatgctggtgtttggagatcttctgtggattcctttcact
tttagcatccagggatggtggcttttgcacaacaaagtagaactaactgttcctggtatt
gtagccaattgctttgtgttcttgatagagtacatggtttttagaggggctaacaaacaa
aaacatatctttaagaaaaaccctaaaacacctatatggggcaaacctccagtggtggtt
ggtggaaagttgcttgcttcaggctattggggaatcgcaaggcactgtaattaccttggc
gacttgatgcttgctctgtctttcagtttgccctgtggaataagttctccggttccatat
ttctacccgatatacctcctgatactgttgatatggagagagcgaagagacgaggaacga
tgtgcagagaagtacaaggagatttggcctaagtatcttagactggttccctatagaatc
cttccttatgtctattaa

DBGET integrated database retrieval system