KEGG   Brassica rapa (field mustard): 103872405Help
Entry
103872405         CDS       T03449                                 

Definition
(RefSeq) heat shock 70 kDa protein 5
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
brp  Brassica rapa (field mustard)
Pathway
brp03040  Spliceosome
brp04141  Protein processing in endoplasmic reticulum
brp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:brp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103872405
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103872405
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103872405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:brp01009]
    103872405
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:brp03041]
    103872405
   03009 Ribosome biogenesis [BR:brp03009]
    103872405
   03110 Chaperones and folding catalysts [BR:brp03110]
    103872405
   04131 Membrane trafficking [BR:brp04131]
    103872405
   03051 Proteasome [BR:brp03051]
    103872405
   03029 Mitochondrial biogenesis [BR:brp03029]
    103872405
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brp04147]
    103872405
Protein phosphatases and associated proteins [BR:brp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103872405
Spliceosome [BR:brp03041]
 Complex B
  Other components
   Prp19 complex
    103872405
 Complex C
   Prp19-CDC5 complex
    103872405
Ribosome biogenesis [BR:brp03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103872405
Chaperones and folding catalysts [BR:brp03110]
 Heat shock proteins
  HSP70 / DNAK
   103872405
Membrane trafficking [BR:brp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103872405
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103872405
Proteasome [BR:brp03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103872405
Mitochondrial biogenesis [BR:brp03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103872405
Exosome [BR:brp04147]
 Exosomal proteins
  Proteins found in most exosomes
   103872405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR GLE1
Motif
Other DBs
NCBI-GeneID: 103872405
NCBI-ProteinID: XP_009149047
UniProt: A0A397YWE1
Position
A6
AA seq 647 aa AA seqDB search
MATKSDKAIGIDLGTTYSCVGVWINDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQ
VALNPHNTVFDAKRLIGRRFTDPSVQSDMRHWPFKVVSGPGDKPMIVVSYKNEEKQFSPE
EISSMVLVKMKEVAESFLGHTVKNAVVTVPAYFNDSQRQATKDAGSISGLNVLRIINEPT
AAAIAYGLDKKGTKTGERNVLIFDLGGGTFDVSLLTIEEGVFEVKATAGDTHLGGEDFDN
RLVNHFVAEFKRKHKKDVSGNARALRRLRTACERAKRTLSSTAQTTIEIDSLHEGVDFYA
TISRARFEEMNMDLFRKCMDPVEKVLRDAKLDKSRVHEVVLVGGSTRIPKIQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILTGEGSDKVQDLLLLDVAPLSLGIETAGGVMTVLIP
RNTTVPCKKEQVFSTYADNQPGVLIQVYEGERARTKDNNLLGTFELKGIPPAPRGVPQIN
VCFDIDANGILNVSAEDKTAGVKNQITITNDKGRLSKEEIEKMVQDAEKYKAEDEQVKKR
VEAKNSLENYAYNMRNTVRDEKLAQKLDQEGKQKIEKAIDETIEWIEGNQLAEVDEFEFK
LKELEGICNPIISKMYQAGAGAGYPDGGMPASGGSGGAGGPKIEEVD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcgactaaatcggataaagctatcggcatcgacctcggcaccacgtacagctgcgtc
ggagtgtggatcaacgaccgcgtggagatcatccccaacgaccaaggcaaccgcacgact
ccttcctacgtcgccttcaccgacacggagcggttgatcggcgacgcggcgaagaatcaa
gtcgcgctgaaccctcacaacaccgtcttcgacgcgaagcgtctcatcgggaggagattc
accgatccgtctgttcagagcgatatgcggcactggccgttcaaggttgtctccggtccc
ggagataagccgatgatcgtggtctcgtataagaacgaagagaagcagttctctcccgag
gagatatcttcgatggtgttggttaagatgaaggaagtcgcagagtcctttttgggtcac
actgttaaaaacgctgtcgttacggtccctgcttactttaatgactctcagagacaggcc
acgaaggacgcgggttcgatctctgggcttaatgttttgaggattattaacgagcccact
gctgcagctattgcttacggtttagacaagaaagggactaagactggtgagaggaacgtt
ttgattttcgatcttggaggtggaacgtttgatgtttcgttgttgacgattgaagaaggt
gtgttcgaagtgaaagctacggctggtgatactcacctcggtggtgaggactttgataac
aggcttgtgaaccatttcgttgcggagttcaagaggaagcataagaaggatgttagtggg
aacgcgagggcgttgcggaggttgagaacggcttgtgagagagcgaagagaacgctttcc
tctactgctcagacgactattgagattgattctttgcacgagggtgttgatttctacgcg
acgatatcgcgtgcgaggtttgaggagatgaacatggatctcttcaggaaatgtatggat
cctgtggagaaagttttgagagatgctaagcttgacaagagccgtgtccatgaggtggtt
cttgttggaggatccacgaggattcctaagattcagcagcttctgcaggacttttttaat
gggaaggagctttgtaaaagcattaatcctgatgaagctgttgcctatggagctgcggtt
caggcggcgattctgactggtgaaggaagcgacaaggtgcaagatcttctgcttcttgac
gtggcgccgctgagcctcggaatcgagacggctggtggagtgatgactgtgttgatcccg
aggaacacgacggttccttgtaagaaggagcaagtgttctctacctatgcggacaatcag
cctggtgttctgatccaagtctatgaaggagagcgtgcgaggactaaagacaacaacctt
cttggaacttttgagctcaaggggatccctcctgcgccgcgtggagtccctcagatcaat
gtttgcttcgacattgacgccaatgggatcttgaacgtgtcggcggaggataaaacggcg
ggtgtgaagaaccagattacgatcacgaacgacaaagggaggttgagcaaagaggagata
gagaagatggtgcaagatgctgagaagtacaaggcggaggatgagcaggtgaagaagaga
gtggaggccaagaactcgctggagaactatgcgtacaacatgagaaacactgtcagggat
gagaaactggcgcagaaactagatcaagaaggtaagcagaagattgagaaggcgattgat
gagacaatcgagtggattgaaggtaaccagctggcggaagttgatgagtttgagttcaag
ttgaaagagctggagggtatctgtaacccaatcatctccaagatgtatcaggctggtgcc
ggtgccggatatcccgatggtggtatgcccgcaagcggtggctccggtggtgctggaggt
ccgaagatagaagaggttgattaa

DBGET integrated database retrieval system