KEGG   Brassica rapa (field mustard): 103873985Help
Entry
103873985         CDS       T03449                                 

Definition
(RefSeq) protein S-acyltransferase 18-like
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
brp  Brassica rapa (field mustard)
Brite
KEGG Orthology (KO) [BR:brp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:brp04131]
    103873985
Enzymes [BR:brp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     103873985
Membrane trafficking [BR:brp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103873985
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 103873985
NCBI-ProteinID: XP_009150640
Position
A6
AA seq 89 aa AA seqDB search
METELKRRLHVVFPRWSLAPISVMLVWLAGYVSAAMGKFFLFYLVLIKKVVPKYLQRMKT
CDYILATGGGNRFTEVDPSDQLDSSSDEI
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgaactcaagagaaggcttcatgtagtgttccctagatggtctcttgctcca
atatctgttatgttggtttggttagcaggctatgtttcagcagccatggggaaatttttc
ctcttctatctggttcttatcaaaaaggtagtgcccaaatacttgcagaggatgaaaaca
tgtgactatatattagcaacggggggaggaaatcggtttacagaagtggacccttctgat
cagttagattcttcttcagatgaaatatga

DBGET integrated database retrieval system