KEGG   Brassica rapa (field mustard): 103874257Help
Entry
103874257         CDS       T03449                                 

Definition
(RefSeq) alpha-humulene/(-)-(E)-beta-caryophyllene synthase-like
  KO
K14184  alpha-humulene/beta-caryophyllene synthase [EC:4.2.3.104 4.2.3.57]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00909  Sesquiterpenoid and triterpenoid biosynthesis
brp01100  Metabolic pathways
brp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    103874257
Enzymes [BR:brp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.57  (-)-beta-caryophyllene synthase
     103874257
    4.2.3.104  alpha-humulene synthase
     103874257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-GeneID: 103874257
NCBI-ProteinID: XP_009150920
Position
A6
AA seq 549 aa AA seqDB search
MSMESEVHRPLADYSANIWEDLLTHFSKSELGSTDTSKEKHRTLKEAVKESFMASKVNPI
ENIKFIDSLSRLGVSYHFEIDIIEQLGNSFDSLDFNRLIRHDECDLYTVGLLFQVFRQFG
FKLSADVFEKFKSEDGKFKEHLVADTSGILSLYEASQWNTHGEDIIDQALAFSSCHLKEI
SFQSIPQHLAVRIKNALKHPYHRGISRIETRKYISYYEAEEKRDAVLLEFAKIDFNMLQI
LHRTELACVTRWYEEMEIKSKVTYTRHRVAEAYLWSIGAYFEPQYSQARVKTAVALIIFT
MLDDTYDAYGTMEELEIFSDAIEKWLPAPPNMIPESMKYVYRIMVDFYEKLDEEFENEGR
SGCGFHLKKSLKTTANGYMQEAKWLKEEYTATFDEYKENAIVSSGYYPLIAMTFAGMGDV
ANLDAFEWLSSNPKIRVASEKISRFTDDISSYEFERKREHVATAIDCYMKQFGVSKEQAV
EGINIMLSDAWKDMNQELMRPHSCPFPLLMRIFNLCRVVDVFYRYQDCYTHPEFLKEHIV
SLFIEDIPI
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagagtgaagtccaccgtccgctagctgattattccgcaaacatctgggaa
gatctcttaactcatttctcaaaatctgagcttggaagtactgatacgtcaaaagaaaag
cataggactctaaaggaggctgtgaaggaatcgtttatggcttcaaaagtgaatcccata
gagaacatcaagttcatcgactctctatctcgccttggtgtctcctatcactttgagata
gacatcatagagcagttgggaaattcatttgatagtcttgattttaatcggttgatacgg
catgatgagtgcgatttgtatactgttgggttgcttttccaagttttcaggcaattcgga
ttcaaactttctgctgatgtgtttgagaagttcaagagcgaggatgggaagtttaaagaa
cacttagtggcagatacaagcggtatattaagcttgtatgaagcttcacaatggaacact
catggagaagatatcatcgaccaagctcttgctttttcaagctgtcacttaaaagagatt
tcttttcaatctatcccccagcatcttgcagtacgcatcaaaaatgctctaaagcatcct
taccacagaggcatctcaaggatagaaacgaggaaatatatatcatactacgaggcagaa
gagaagcgtgacgcagttttacttgagtttgcaaagatagatttcaatatgctccaaata
ttgcaccgcacagagcttgcttgcgtaacaaggtggtacgaagaaatggaaattaaatct
aaagtaacatacacaaggcatagagtagcagaggcgtacttgtggtcaattggggcatat
ttcgagcctcaatattctcaagcacgagttaaaacagctgttgcactaatcatattcaca
atgcttgatgatacgtatgatgcctatggcacaatggaggaacttgagattttctcagat
gcaatagaaaagtggcttcccgctccgcctaacatgatacctgagagcatgaagtacgtg
taccgtatcatggtagatttctatgaaaaacttgatgaggaatttgagaacgaaggaagg
tcaggttgtggctttcatcttaagaaatcattgaagacaacggcgaatggatatatgcaa
gaggcaaagtggttgaaagaagagtacactgctacatttgacgagtataaagagaatgcg
atagtgagttccggttactatcccttgattgcaatgaccttcgcaggaatgggagatgtc
gcaaatcttgatgcttttgaatggttaagctcaaaccctaaaattagggtagcttcagag
aaaatcagtcgattcacagatgacatttctagctacgagtttgaacgaaaaagggagcat
gtagcaacggctattgactgctatatgaagcaatttggtgtttccaaggaacaagcagtg
gaaggaataaatatcatgctttctgatgcatggaaagacatgaaccaagagctaatgagg
cctcactcatgtcctttccctcttttgatgcgaatttttaacctatgccgtgtcgtcgat
gtattctataggtaccaagattgttacacccaccctgagttcctgaaagagcacatcgtc
tccttgttcattgaagacatacccatttaa

DBGET integrated database retrieval system