KEGG   Brassica rapa (field mustard): 103874543Help
Entry
103874543         CDS       T03449                                 

Definition
(RefSeq) glutathione synthetase, chloroplastic
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
brp  Brassica rapa (field mustard)
Pathway
brp00270  Cysteine and methionine metabolism
brp00480  Glutathione metabolism
brp01100  Metabolic pathways
Module
brp_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:brp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    103874543
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103874543
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brp04147]
    103874543
Enzymes [BR:brp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     103874543
Exosome [BR:brp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103874543
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase DUF5462
Motif
Other DBs
NCBI-GeneID: 103874543
NCBI-ProteinID: XP_009151213
Position
A6
AA seq 478 aa AA seqDB search
MESHKPMFQVENFDDEFVQKLVYDALVWCSLHGLVVGDKTYQKSGTVPGVGMTHAPISLL
PTQFPESYWKQACEVAPIFNELVDRVSLDAQFIQDSLSRTKKADIFTSRLLDIHSKMLES
NKKEDIRLGLHRSDYMLDEETKSLLQIEMNTISCSFPGFGRLVTELHQSLLRSHGDHLGL
DSERVPKNTSNSQFADAMAKAWLEYNNPRAVVMIVVQPDERNMYDQHWLSSVLREKHSIV
TIRKSLAEVETEGSVQEDGTLIVDGQEVSVVYYRSGYTPRDYPSESEWNARLLIEQSSAV
KCPSIAYHLAGTKKIQQELAKPGVLERFMDNKDDVAKLRKCFAGLWSLDDPEIIKKAIEK
PELFVMKPQREGGGNNIYGDDVRENLLRLQKEGEEENAAYILMQRIFPKVSNVFLVREGV
YHRDQAISELGIYGAYLRNKERVIINEQSGYLMRTKVSSSDEGGVAAGFAVLDSIYLN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaatcacacaaacccatgttccaagtcgaaaactttgacgacgagtttgtccagaaa
ctggtctatgatgctctcgtttggtgttcccttcacgggctcgtcgttggtgacaaaact
tatcagaaatcaggaacagttccaggggttggtatgacgcacgccccgatttcattgctg
ccaactcagttcccagaaagttactggaagcaagcttgtgaagttgctcctatcttcaat
gaactggttgatcgtgtcagcttggatgcccaattcatacaggacagtctctccagaacg
aagaaagccgacatctttacatctagacttcttgacattcactccaagatgctagaaagc
aacaagaaagaggacattcgtttgggtttacaccggtcagattatatgctagacgaagaa
acaaaatcgcttcttcagatagagatgaatactatttcctgttcctttccaggctttggt
cgtcttgttaccgagctacaccagtcattgcttagatctcatggggatcatcttggccta
gactctgaacgtgtacccaaaaacacatccaatagccagtttgctgacgcaatggctaaa
gcttggttggagtacaacaacccaagagcggtagtcatgatagttgtgcagccggatgaa
cgcaacatgtacgatcagcattggctaagcagcgtactgagagaaaagcacagtattgta
accattaggaagagtttagcagaagtcgaaacagaagggagtgtacaagaggatggaacc
cttattgttgatggccaagaagtctcggtggtttattacagatcaggctatactcccaga
gattatccgtctgaatcagaatggaatgctaggctgcttatagagcagtcctcagcagtt
aaatgcccctctatagcttatcacttagctggcaccaagaaaatccagcaagaacttgca
aaaccaggtgttctcgagaggtttatggataacaaagatgacgttgctaagctgaggaaa
tgctttgctggactttggagcttggacgatccagaaatcatcaagaaagcaattgagaaa
cctgagttgtttgttatgaagcctcagagagaaggaggaggtaacaacatctatggagat
gatgtgagggaaaatcttctgaggttgcagaaagaaggagaggaagagaacgctgcgtat
atcctaatgcagaggatattcccaaaagtgtcaaatgttttcttggtgcgagaaggcgtt
taccacagagatcaagctatatcagaacttggaatctatggtgcttacctcaggaacaag
gagagagttataataaacgagcagagcggttatctgatgcgcacaaaggtctcgtcatca
gatgaaggtggtgttgcggctggttttgccgtcttggacagcatttatttgaattga

DBGET integrated database retrieval system