KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_04160Help
Entry
CIT40_04160       CDS       T05700                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Pathway
brq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CIT40_04160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:brq02022]
    CIT40_04160
Two-component system [BR:brq02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   CIT40_04160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AWL99293
UniProt: A0A2U8PNH4
Position
complement(855598..856329)
Genome map
AA seq 243 aa AA seqDB search
MTVPLAATLARPPARPADDAPHLLLVDDDRRIRDLLSRFLAAEGYRVTTAASAGDARSKL
LGLHFDLLILDVMMPGETGFDLARFIRTSSSVPIVMLTARHEAEARIEGLQIGADDYVAK
PFEPRELALRINNILKRAAPPPQATAVEKIAFGPYIYHLDRGELRQGEEVIHLTDREREM
LRILSETPGETVPRSALTGNGSVNERAVDVQINRLRRKIETDPANPLFLQAVRGIGYRLV
ASP
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgccacttgctgccacgctcgcccgcccgccagcgcgcccggccgatgatgcg
ccgcatctgctgctcgtcgacgacgaccgccgcatccgcgatctgctctcgcgcttcctc
gccgctgaaggctaccgcgtcaccaccgccgcgagtgccggcgatgcgcgctcgaagctg
ctgggtctgcatttcgacctcttgatcctcgacgtcatgatgcccggcgagaccggcttc
gatctggcccgcttcatccgcacctcctcctcggtgccgatcgtgatgctgacggcgcgc
cacgaggcggaagcgcgtatcgagggcctgcagatcggcgccgacgactacgtggcaaaa
ccgttcgagccgcgcgagctggcgctgcgcatcaacaacatcctcaagcgcgccgcgccg
ccgccgcaggccacagcggtggagaagatcgcgttcggtccctacatctatcatctcgat
cgcggcgagctgcggcagggcgaggaggtcatccacctcaccgaccgcgaacgcgagatg
ctgcgcattctctccgagactccgggcgagaccgtgccgcgcagtgcgctgaccggcaac
ggcagcgtcaacgagcgcgccgtcgacgtgcagatcaaccggctcaggcgcaagatcgag
accgaccccgccaatccgctgttcctccaggcggtgcgcggcatcggctaccgcctggtg
gcctcgccataa

DBGET integrated database retrieval system