KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_09275Help
Entry
CIT40_09275       CDS       T05700                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Pathway
brq00970  Aminoacyl-tRNA biosynthesis
brq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CIT40_09275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:brq03029]
    CIT40_09275
Enzymes [BR:brq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CIT40_09275
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CIT40_09275
Mitochondrial biogenesis [BR:brq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CIT40_09275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AWM00203
UniProt: A0A2U8PQX3
Position
2024986..2026335
Genome map
AA seq 449 aa AA seqDB search
MPEFPTLAQLAEDLESGRTTARKLVEGCIAKIADPAGEGQRTFLHVDKDAALAAADAMDG
LRKAKAAPSRYAGIPVSIKDLFDIKGQVTRAGSRALDDSPPAEQDAATVARLRRAGFVVI
GRTNMTEFAYSGIGINPHYGTPKGTWNRTVGHVPGGSSSGAAVSVLDGMAHGALGTDTGG
SCRIPAAYNGIVGYKPTQRRVPLDGSVPLSFSLDSIGPLARSVSCCAILDAVLANEPIVP
LKPRPVRGMRLAVPTTIALDDLDTEVAETFERALKTLSDHGAIIERIEMAEFHDIGPMNA
KGGFAASESYAWHRYLLTAKGDVYDPRVSVRIMRGEAQSAADYIDLLNERRSLIARVNAR
IAPYDALVLPTTANTPPEIADLADDKAFTIQNLRALRNCTLINMIDGCAISLPAHRQGEI
PVGLMLAGAGGTDRRIFELAAGMEAVIRV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattcccgacactggcgcagctcgccgaagacctcgaaagcggccgcaccacc
gcccgcaagctggtcgaaggctgcatcgccaaaatcgccgatcccgccggggaaggccag
cgcaccttcctccatgtcgacaaggacgccgcgctcgccgcggcggacgcaatggacggc
ttgcgcaaggccaaggcggcgccgtcgcgctatgccggcatcccggtctcgatcaaggac
ctgttcgacatcaagggccaggtgacgcgcgccggctcccgagccctcgacgattccccg
ccggccgagcaggatgccgcgacggtggcgcggctgcgcagggccggcttcgtcgtgatc
gggcgcaccaacatgaccgagttcgcctattccggcatcggcatcaatccgcattacggc
acgccgaagggcacctggaaccggacggtgggacatgtgcccggtggctcgtcctcgggc
gcggcggtgtccgtgctcgacggcatggcgcatggcgcgctcggcaccgacaccggcggc
tcctgccgcattccagcggcctataacggcatcgtcggctacaagccgacgcagcggcgc
gtgccgctcgatggctcggtgccgctgtcgttctcgctcgacagcatcgggccgctggcg
cgatcggtcagctgctgtgccatactcgacgccgtgctcgccaacgagccgatcgtcccg
ctgaagccgcggcccgttcggggcatgcggctggcggtgccgaccacgatcgcgctcgac
gatctcgataccgaggtggccgagacgttcgaacgcgccctgaagacgctgtccgatcac
ggcgcgatcatcgagcgcatcgagatggccgaattccacgatatcggcccgatgaacgcc
aagggcggctttgcggcgtccgagagctacgcctggcatcgctatctcctcacggcgaag
ggtgacgtctacgaccccagagtgtccgtgcgtatcatgcgcggcgaggcgcagagtgcg
gccgactacatcgatctcctcaacgagcgccgctcgctaatcgctcgcgtcaacgcgcgc
atcgcgccgtacgacgccctggtgctgccgaccaccgccaacacgccgccagagatcgcc
gatctcgccgacgacaaggccttcaccatccagaacctgcgcgcgctgcgcaactgcacc
ctgatcaacatgatcgacggctgtgccatctcgctgcccgcgcatcgccagggcgaaatt
cccgtcggcctgatgctggcgggtgcgggcggcaccgaccgccgtatcttcgagcttgct
gccggcatggaggccgtcattcgtgtttga

DBGET integrated database retrieval system