KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_22015Help
Entry
CIT40_22015       CDS       T05700                                 

Definition
(GenBank) SDR family NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Pathway
brq00520  Amino sugar and nucleotide sugar metabolism
brq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CIT40_22015
Enzymes [BR:brq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     CIT40_22015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: AWM02436
UniProt: A0A2U8PX79
Position
4683708..4684670
Genome map
AA seq 320 aa AA seqDB search
MPFESYKNSRILVTGGAGFIGSHICERLLDAGAEVVSADNYFTGSRRNISHLIANPLFEA
VRHDVTFPLYIEVDAIFNLACPASPIHYQRDPVQTTKTSVHGAINMLGLAKRLKARIFQA
STSEVYGDPLIHPQTEEYWGNVNPIGIRSCYDEGKRCAETLFFDYWRQHGLPIKVARIFN
TYGPRMQPNDGRVVSSFIVQALKGEPITVFGDGGQTRSFCYVDDLVEAIMRLMVTAEEVT
GPINLGNNSEFTIRELAEKVIKLTGSRSQLVFKPLPQDDPRQRQPDLTKAKALLDWEPKV
ALEDGLKETIAYFKHSLDIA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgaaagctacaagaacagccgcatcctcgtgaccggaggcgccgggttcatc
ggatcgcacatctgcgagcgactgctcgatgccggggccgaggtggtatcggcggacaat
tatttcaccggcagccggcgcaacatctcccatctgatcgcgaatccactgttcgaggcg
gtcaggcacgacgtcacctttccgctctacatcgaggtcgacgcgatcttcaacctggcc
tgcccggcctcgccgatccactaccagcgcgaccccgtgcagaccaccaagacctcggtg
cacggcgccatcaacatgctggggctcgccaagcggctcaaggcgcgcatcttccaggcc
tcgaccagcgaggtctatggcgatccgctgatccatccgcagaccgaggagtactggggc
aacgtcaacccgatcggcatccgctcctgctacgacgagggcaagcgctgcgccgagacg
ctgttcttcgactattggcgtcaacacggcctgccgatcaaagtcgcgcgcatcttcaac
acctatggaccgcgcatgcagcccaatgacggccgcgtggtgtcgtccttcatcgtccag
gcgctgaagggcgagccgatcacggtgttcggcgacggcgggcagacccgctcgttctgc
tatgtcgacgacctcgtcgaggccatcatgcgcttgatggtgaccgcggaagaggttacc
ggcccgatcaatctcggcaacaattccgagttcacgatccgcgagctcgccgagaaggtc
atcaagctcacgggctcgcgctcccaattggtgttcaagccgctgccgcaggacgaccca
cgccagcgccagcccgacctcaccaaggcgaaggcgctgctcgactgggagccgaaggtc
gcgctcgaggacgggctgaaggaaacgatcgcctacttcaagcactcgctcgatatcgcc
tga

DBGET integrated database retrieval system