KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_23835Help
Entry
CIT40_23835       CDS       T05700                                 

Definition
(GenBank) ferredoxin:protochlorophyllide reductase (ATP-dependent) subunit B
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Pathway
brq00860  Porphyrin and chlorophyll metabolism
brq01100  Metabolic pathways
brq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CIT40_23835
Enzymes [BR:brq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     CIT40_23835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red
Motif
Other DBs
NCBI-ProteinID: AWM02758
UniProt: A0A2U8PZU9
Position
complement(5095189..5096754)
Genome map
AA seq 521 aa AA seqDB search
MQLTVWTYEGPPHVGAMRVATGMDGLHYVLHAPQGDTYADLLFTMIERRDRRPPVTYTTF
SARDLGGDTADLFKSAAQNAYDRFQPQAMLVGASCTGSLIQDDPGGLARALDLPIPVVAV
DLPAYQRKENWGAAETFYQLVRTLAGPSAPAPGRPRPQRAAGVRPRCNLLGPTALGFRHR
DDIVEITSLLAKLGIDVNVTAPMGATPADIAGLGEADFNVVLYPEIAGQTASWLQRTFGQ
PFTKTVPIGVSATREFVEEVARLAGVDASATLASASTRLPWYSRSVDSTYLTGKRVFIFG
DATHAVAAARIASDELGFMVVGLGTYSREFGREIRDAAKRYDVEPLITDDYLEVEAKIAE
LQPELVLGTQMERHIAKRLGIPCAVISAPVHVQDFPARYAPQMGFEGANVIFDTWVHPLM
MGLEEHLLAMFKDDFEFKDGTVPSHLGAGHSSPVADRPVQVSVSESNIAAVWAADAEKEL
HKIPFFVRGKARRNTERFANENGVATITIETLYDAKAHYAR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcacggtgtggacctatgaaggacctccccatgtcggcgcgatgcgtgtcgcg
acgggaatggacggcctgcattacgtcctgcacgccccgcagggcgacacctacgcggat
ctgctgttcacgatgatcgaacgccgcgaccggcgcccgcccgtgacgtacacaacattc
tccgcccgggatctcggcggtgacaccgccgatctgttcaagtccgcggcccagaatgcc
tatgatcgtttccagccgcaggcgatgctcgtcggcgcgtcctgcacggggtcgctgatc
caggacgacccgggcggtctagcgcgtgcgctcgatctcccgatccccgtcgtggccgtc
gatctgccggcctatcagcgcaaggaaaactggggcgcggccgaaacgttctatcaattg
gtgcgcacgctcgccgggccgtcagcgccggcacccggaagaccgcgtccccagcgtgct
gcgggagtccgtcctcgctgcaatctgctcggcccaaccgctctcggtttccgccatcgc
gacgatatcgtcgagatcacctcgctgctggcaaagcttggcattgacgtgaacgtcaca
gcgccgatgggggcgaccccggccgatatcgcaggacttggcgaggccgactttaacgtc
gtgctgtatcccgaaatcgcgggccagactgcgtcctggctgcaacggacgtttggacag
cccttcactaagaccgtcccgatcggcgtgtcggccacccgcgaattcgtcgaagaggtc
gcaaggctcgctggtgtcgatgcgtcggcgacgctggcctcggcctccacccggctgccg
tggtactcgcgctcagtcgattcgacctatctcactggcaagcgcgtcttcatttttggc
gacgccacccacgcggttgccgctgcccgcattgcatccgacgaactcggcttcatggtc
gttggcctcggcacctacagccgcgaattcggccgcgagatccgcgacgcagcgaaacga
tatgacgtcgaaccgctgatcactgacgactatctagaggtcgaggcgaagatcgcggaa
ctacagcccgagttggtgctggggacgcagatggagcggcacatcgccaagcgtctcggc
attccatgcgccgtgatctcggcgccggtgcatgtgcaggattttcccgcacgctacgca
ccgcagatgggttttgagggcgccaacgtcatcttcgacacctgggtgcatccgctgatg
atgggcctcgaggaacacctgctggcaatgttcaaggatgatttcgaattcaaggacggc
acggtaccgtcgcatctgggcgcgggtcattcatcgcccgttgctgatcggccggttcag
gtatccgtcagtgagtcgaacatcgcggccgtttgggcagccgacgccgagaaagagttg
cacaaaattccgttcttcgttcgtggcaaggcgcgccgcaataccgaacgtttcgccaat
gaaaacggcgttgccaccataaccatcgagacgctctacgatgccaaagcgcattacgcc
cgttga

DBGET integrated database retrieval system