KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_26535Help
Entry
CIT40_26535       CDS       T05700                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Pathway
brq00230  Purine metabolism
brq00250  Alanine, aspartate and glutamate metabolism
brq01100  Metabolic pathways
Module
brq_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:brq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CIT40_26535
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CIT40_26535
Enzymes [BR:brq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CIT40_26535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AWM03247
UniProt: A0A2U8PZM7
Position
complement(5663134..5664426)
Genome map
AA seq 430 aa AA seqDB search
MANVVVVGAQWGDEGKGKIVDWLSEQADIVVRFQGGHNAGHTLVINGKTYKLALLPSGVL
RDQKLSVIGNGVVFDPAAFLDEVTKLRSQGVAVSPENLRVAENVTLILPLHRELDAHRES
ANAATAIGTTRRGIGPAYEDKVGRRAIRLMDLADLDTLPHKIDRLLAHHNALRRGLGLPE
FDGKVILKELSALAPELLPYAETVWRLLDIKRREGKRMLFEGAQGALLDVDHGTYPYVTS
SNTVAAQAATGSGLGPGAVGYVLGLCKAYTTRVGQGPFPTEQDNETGRRIGERGREFGTN
TGRPRRCGWFDAVLVRQAVRTCGINGLALTKLDILDGFDTIEVCTGYKLDGKEIDHFPAG
EGAQARVEPIYETIEGWKEPTAGARSWAQLPAQAIKYVRRIEELVGCPVALLSTSPERED
TILVQNPFEA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgttgtcgtcgtcggcgcccagtggggcgacgaaggaaagggcaagatcgtc
gactggttgtcggagcaggcggacatcgtcgtccgtttccagggcggtcataatgccggc
cacacgctggtgatcaacggcaagacctacaagctcgcgctgctgccctcgggcgtgctg
cgcgaccagaagttgtcggtgatcggcaatggcgtggtgttcgatcccgccgccttcctc
gacgaggtcaccaagctcaggtctcagggcgtcgcggtctcgccggagaatttgcgtgtc
gccgagaacgtcacgctgatcctgccgctgcaccgcgagctcgatgcccatcgcgaatcc
gccaatgcggcgactgcgatcggcaccacccgccgcggcatcgggcctgcctatgaagac
aaggtcggccgccgcgccatccgcctgatggacctcgccgatctcgacacgctcccgcac
aagatcgaccggttgcttgcccaccacaacgcactgcggcgcggcctcggcctgcccgaa
ttcgacggcaaggtgatcttgaaggagttgagcgcgctggcgccggagctgctgccctat
gccgagacggtttggcggctgctcgacatcaagcgccgcgaaggcaagcggatgctgttc
gagggggcgcagggcgcgctgctcgacgtcgaccacggcacttatccctacgtcacctcg
tccaacacggtggcggcgcaggcggcgaccggctcgggcctcggccccggtgcggtcggt
tacgtgctcggcctgtgcaaggcctacaccacccgcgtcggccagggcccgttcccgacc
gagcaggacaacgagaccggccgccggatcggcgaacgcggccgcgagttcggcaccaac
accggccgtccgcgccgctgcggctggttcgacgccgtgctggtccgccaggcggtccgc
acttgcggcatcaacggcctcgcgctgaccaagctcgacatcctcgacggcttcgacacc
atcgaggtctgcaccggctacaagctggacggcaaggagatcgaccatttccccgccggc
gagggcgcccaggcccgggtcgagccgatctacgagaccatcgagggctggaaggagccg
accgccggggcgcggtcctgggcccagctgccggcccaggccatcaaatatgtccgtcgg
atcgaggaattggtggggtgcccggtcgcgctgctttccaccagccccgaacgcgaagat
actatcctcgtgcaaaacccgtttgaggcttaa

DBGET integrated database retrieval system