KEGG   Bradyrhizobium sp. 2 39S1MB: CIT40_29905Help
Entry
CIT40_29905       CDS       T05700                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
brq  Bradyrhizobium sp. 2 39S1MB
Brite
KEGG Orthology (KO) [BR:brq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CIT40_29905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 LTD Paramyxo_NS_C
Motif
Other DBs
NCBI-ProteinID: AWM03826
UniProt: A0A2U8Q169
Position
6364493..6364897
Genome map
AA seq 134 aa AA seqDB search
MVAAMYRAVTRHIEVTVEPNFVPEQSSADRSRYFWSYTIVITNSGEETVQLKTRHWIITD
ASGRQQEIKGEGVVGEQPTLAPGERFEYTSGVPLSTASGFMTGRYQMVTKSGERFEIDVP
AFSLDSPDSKRVLN
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggtagcagccatgtaccgcgccgtgacccgccacatcgaagtgaccgtcgagccgaac
tttgttccggaacaatcctcggccgaccgttcccgctatttctggtcctacaccatcgtc
atcacaaattcgggcgaggagaccgtgcagctcaagacgcggcactggatcatcaccgac
gcctccggccgccagcaggagatcaagggcgaaggcgtggtcggcgagcagccgacgctg
gcccccggcgagcgcttcgaatacacctcgggcgtcccactctcgaccgcctccggtttc
atgaccggccgctatcagatggtcaccaaaagcggcgagcgcttcgagatcgacgtcccg
gcattttcgctggacagcccggacagcaagcgagtgttgaactag

DBGET integrated database retrieval system