KEGG   Brachybacterium sp. SGAir0954: C1N80_07090Help
Entry
C1N80_07090       CDS       T06008                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
brr  Brachybacterium sp. SGAir0954
Pathway
brr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:brr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C1N80_07090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:brr03011]
    C1N80_07090
Ribosome [BR:brr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C1N80_07090
  Bacteria
    C1N80_07090
  Archaea
    C1N80_07090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QCR53367
UniProt: A0A4V1FKG3
Position
1579370..1579723
Genome map
AA seq 117 aa AA seqDB search
MEAKAQVRYLRMSPMKARRVVDLIRGKSTVEALDTLRFAPQAASEPVLKLVQSAIANARV
KADQAGERFDERELVVSAAYVDEGPTMKRFQPRAQGRAFQIKKRTSHVTVVVAPVNK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaggcgcaggtgcggtacctccgcatgtcgcccatgaaggctcgccgcgtt
gtcgacctgattcgtggcaagagcacggttgaggccctggacaccctgcggttcgccccg
caggccgccagcgagcccgtcctcaagctcgtccagtccgcgatcgccaacgctcgcgtc
aaggccgaccaggcgggtgagcgcttcgacgagcgcgagctcgtcgtctcggccgcctat
gtcgacgagggcccgaccatgaagcggttccagccgcgtgcacagggtcgagccttccag
atcaagaagcgcaccagccacgtcaccgtggtggtcgctcccgtgaacaagtaa

DBGET integrated database retrieval system