KEGG   Bradyrhizobium sp. S23321: S23_19160Help
Entry
S23_19160         CDS       T01796                                 

Gene name
crtF
Definition
(GenBank) hydroxynuerosporene O-methyltransferase CrtF
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00906  Carotenoid biosynthesis
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    S23_19160 (crtF)
Enzymes [BR:brs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     S23_19160 (crtF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_12 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: BAL75129
UniProt: I0G2Z2
Position
2012267..2013376
Genome map
AA seq 369 aa AA seqDB search
MHDRLLGWRDSILANPGFQRFAGSFALTRPIARRRASALFDLCAGFVYSQVLFACVRLKL
FDQLADGPLDSAELALLVPLPADATSTLLDAAVSLQLLQRRSDGRYGLGSLGAALRGNPG
VAAMIEHHAMLYDDLKDPIALLRGDVGAGQLAAYWPYAGNRKAANLSREAIAPYTALMAM
SQPMISQQVLSAYSFRGHRCLLDIGGGDGSFIVAVAAQAPKLRCVLLDLPAVADQASERF
RAEGLSSRAVAIGGSFLANRLPEGADIVSLVRVIHDHDDADIMTLLRAVHLALPPDGTLL
IAEPISGVRGAEPIGDAYFAFYLLAMGSGRPRTFVRLRDMLTEAGFVDIALRPVAMPMLA
SVITAKKRN
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttgcatgatcgcctgctaggctggcgcgattcgatcctggcaaatccgggctttcagcga
tttgcagggagttttgctctgacgcggccgatcgcgcggcgtcgggcgagcgcgctgttc
gatctctgtgccggcttcgtctattcgcaagtcttgtttgcgtgcgtccgtttgaagctg
ttcgatcaactggcggatggcccgctggattcggcagagttggctctgctcgtaccgttg
ccggcggatgcgacgtcgacgctgctcgatgcagcggtctcgttgcaattgctgcagcgt
cgcagcgacggccgctacggtctcggatcgcttggcgcagccctgcggggcaatcccggc
gtcgccgccatgatcgagcatcatgcgatgttgtacgacgacctgaaggatccgatcgcg
ctgctgcgcggtgatgtcggggcggggcagctcgccgcttactggccttatgcaggcaat
cgcaaggccgccaatctgtcgcgtgaggcgatcgcgccatacaccgcattgatggcgatg
tcgcagccgatgatctcgcagcaggtgctgtcggcttattccttccgcgggcatcgctgc
ctgctcgacattggcggaggcgacggctccttcatagtcgccgtcgcggcacaggcacca
aaactgcgctgcgtgctgttggatttgcccgcagtggccgaccaggccagcgaacgtttt
cgtgcggagggtctgtcatcacgcgcggtcgcaattggcgggagcttccttgcgaaccgt
ctgcccgagggggccgatatcgtttcgctggtgcgggtgatccatgatcacgacgacgcc
gacatcatgaccctgctgcgcgctgttcacctggccctgccacccgacggcacgcttctg
attgccgagcccatctccggcgtccgcggagccgagccgatcggggacgcctacttcgcc
ttctatctgctggcgatgggcagcggccgcccccggaccttcgtgcggctgcgcgacatg
ctcaccgaggctggctttgtcgatattgcgctgcggccggtcgcgatgccgatgttggcg
agcgtgatcaccgcgaaaaagcgaaattga

DBGET integrated database retrieval system