KEGG   Bradyrhizobium sp. S23321: S23_21250Help
Entry
S23_21250         CDS       T01796                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00051  Fructose and mannose metabolism
brs01100  Metabolic pathways
brs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:brs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    S23_21250
Enzymes [BR:brs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     S23_21250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: BAL75338
UniProt: I0G3K1
Position
2235187..2235834
Genome map
AA seq 215 aa AA seqDB search
MTADELAKRQAIIDACRRMNALGINQGTSGNISVRHADGLLVTPTSVPYEAMTADQIVFM
AMDGVHAPGQKPSSEWRFHRDILQSRADVDAVVHAHPTYCTILAIMGMDIPPVHYMIAAA
GGDSIRCAPYATFGTAELSGHAVRALEGRLACLLDHHGMIAIGRTLDKAMWLAVEVETLA
RQYHGCLQIGTPPLLPSDEIERVRQRMAGYGLSEG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggacgagctcgcaaagagacaggccatcatcgacgcttgccgccgcatgaat
gcgcttggcatcaaccagggcacctctggcaatatcagcgtccgacatgcggacgggctc
ctggtcacgcccacgagcgtgccctatgaggccatgacggccgaccagatcgtgttcatg
gcgatggacggcgtgcatgcgcccggtcagaagccgtcgagcgaatggcgcttccatcgc
gacatcctgcagtcgcgcgccgacgtcgacgccgtcgtccatgcccatccgacctattgc
accatcctggcgatcatgggcatggacatcccgcccgtgcactacatgatcgccgctgcc
ggcggcgacagcatccgctgcgcgccctacgcgaccttcggcacggcggagctgtccggg
cacgcggtgcgggcgttggaggggcggctcgcctgcctgctcgaccaccacggcatgatc
gcgatcggcaggacgctcgacaaggcgatgtggctcgccgtcgaggtcgagacgctggcg
cggcaatatcatggctgtctccagatcgggacgccgccgctgcttcccagtgacgagatc
gaacgggtccgccagcgcatggccggctacggactgtcggaagggtag

DBGET integrated database retrieval system