KEGG   Bradyrhizobium sp. S23321: S23_33710Help
Entry
S23_33710         CDS       T01796                                 

Gene name
kdsA
Definition
(GenBank) 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00540  Lipopolysaccharide biosynthesis
brs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brs00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    S23_33710 (kdsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:brs01005]
    S23_33710 (kdsA)
Enzymes [BR:brs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     S23_33710 (kdsA)
Lipopolysaccharide biosynthesis proteins [BR:brs01005]
 Unusual sugar
  S23_33710 (kdsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: BAL76572
UniProt: I0G735
Position
3458431..3459282
Genome map
AA seq 283 aa AA seqDB search
MSSPASAAPVVTIGTVKFGNDLPISIIAGPCQLESRQHALEVASALKEIAARLKVGLVYK
TSFDKANRTSASAARGLGLAQSLPIFAEIRSSLGLPVLTDVHDAAQCAEVAQAVDILQIP
AFLCRQTDLLLAAAATGKVVNVKKGQFLAPWDMANVVAKITSANNPNVLVTERGVSFGYN
TLVSDMRALPIMARTTGAPVIFDATHSVQQPGGKGASSGGEREFVPVLARAAVAVGVAGV
FIETHPDPDRAPSDGPNMVPLREFEGLIRNLMAFDALAKSTTR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgagctctccagcatcggcggcgccggtcgtcaccattggaacggtcaagttcggcaat
gatctgccgatctcgatcatcgcgggaccctgccagctcgaaagccgccagcacgcgctg
gaggtggcctccgcgctgaaggagatcgccgcgcggctgaaggtcgggctcgtctacaag
acctcgttcgacaaggccaatcgcaccagcgcatccgctgcgcgcggcctcggccttgcg
cagtcgctgccgatcttcgccgagatccgttcctcgctcggcctgccggtgctgaccgac
gtgcacgatgccgcgcagtgcgccgaggtggcacaggcggtggacatcctgcagatcccg
gccttcctgtgccggcagaccgacctgttgctcgcggccgccgcgaccggcaaggtcgtc
aacgtcaagaaggggcaattcctcgcgccctgggacatggcgaatgtcgtggccaagatc
accagcgcgaacaatcccaacgtgctcgtcaccgagcgcggcgtatccttcggctacaac
acgctggtctccgacatgcgcgcgctgccgatcatggcgcgcaccacgggcgcgcccgtg
atcttcgatgccacccattcggtgcagcagccgggcgggaagggagcgtcttcgggcggc
gaacgtgaattcgtgccggtgctggcgcgcgcggccgtcgcggtcggcgtcgccggcgtc
ttcatcgagacccatccggatcccgatcgcgcgccgtcggacggccccaacatggtgccg
ctgcgcgagttcgagggactgatccgcaacctgatggcgttcgacgcgctggccaagagc
accacgcgctga

DBGET integrated database retrieval system