KEGG   Bradyrhizobium sp. S23321: S23_42170Help
Entry
S23_42170         CDS       T01796                                 

Definition
(GenBank) hypothetical protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
brs  Bradyrhizobium sp. S23321
Brite
KEGG Orthology (KO) [BR:brs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    S23_42170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAL77412
UniProt: I0G9H5
Position
complement(4304885..4305892)
Genome map
AA seq 335 aa AA seqDB search
MDAALGLPVLVGLIAVALLFDFLNGLHDAANSIATIVSTRVLRPQFAVFWAAFFNFVAFM
VFGLHVAQTIGTGIIDPAIVDAQVIFAALVGAIVWNLVTWALGIPSSSSHALIGGLFGAG
VAKAGVSAAVWSGLSKTVIAIVLSPLVGFLLAMVLVAIVSWASVRSTPFAVDRAFRILQF
ASASLYSLGHGGNDAQKTMGIIAVLLYSQGQLGGDFFVPFWVVLSCQAAMAMGTLMGGWR
IVRTMGLRITKLTPMQGFCAETGGAATLFMATFLGVPVSTTHTITGAIVGVGAARRLSAV
RWNVASSIVYAWVITMPASAIVAALTWWAVKIFVR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggatgctgcgttgggtctacccgtcctggtcggattgattgccgtcgcgctgctgttc
gatttcctgaacggcctgcacgatgccgccaattcgatcgcgaccatcgtctccacccgg
gtgctgcggccgcaattcgcggttttctgggccgctttcttcaatttcgtcgccttcatg
gtgttcgggctgcacgtcgcccagaccatcggcaccggcatcatcgatcccgcgatcgtc
gatgcgcaggtgatcttcgcggctctcgtcggcgccatcgtctggaacctcgtgacctgg
gcgctcggcattccgtcatcgtcgtcgcacgcgctgatcggcgggttgttcggtgcaggc
gtcgccaaggccggggtttcggcggcggtctggagcggattgtccaagacggtgatcgcg
atcgtcctctccccgctggtcggattcctgctggcgatggtgctggtggcgatcgtgtcc
tgggcgtcggtgcggtcgacgccgttcgcggtcgaccgcgccttccgcatcctgcagttc
gcgtccgcatcgctctattcgctcggccatggtggtaacgacgcgcagaagaccatgggc
atcatcgccgtgctgctctattcgcagggccaactcggcggcgatttcttcgtgccgttc
tgggtcgtgctgtcgtgccaggcagcgatggcgatggggacgctgatgggcggctggcgc
atcgtgcgcacgatgggattgcgcattaccaaattgacgccgatgcagggcttttgcgcc
gaaaccggtggcgccgctacgctgttcatggcgaccttcctcggggttcccgtctcgacc
acccataccatcaccggcgccatcgtcggcgtcggcgcagcccgccgcctctcggcggtg
cgctggaacgtcgccagctcgatcgtctatgcttgggtgatcacgatgccagcctcggcg
atcgtcgcggctctgacctggtgggcggtcaagatcttcgtcaggtga

DBGET integrated database retrieval system