KEGG   Bradyrhizobium sp. S23321: S23_42900Help
Entry
S23_42900         CDS       T01796                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00071  Fatty acid degradation
brs00072  Synthesis and degradation of ketone bodies
brs00280  Valine, leucine and isoleucine degradation
brs00310  Lysine degradation
brs00362  Benzoate degradation
brs00380  Tryptophan metabolism
brs00620  Pyruvate metabolism
brs00630  Glyoxylate and dicarboxylate metabolism
brs00640  Propanoate metabolism
brs00650  Butanoate metabolism
brs00900  Terpenoid backbone biosynthesis
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
brs01120  Microbial metabolism in diverse environments
brs01130  Biosynthesis of antibiotics
brs01200  Carbon metabolism
brs01212  Fatty acid metabolism
brs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    S23_42900
   00630 Glyoxylate and dicarboxylate metabolism
    S23_42900
   00640 Propanoate metabolism
    S23_42900
   00650 Butanoate metabolism
    S23_42900
  Lipid metabolism
   00071 Fatty acid degradation
    S23_42900
   00072 Synthesis and degradation of ketone bodies
    S23_42900
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S23_42900
   00310 Lysine degradation
    S23_42900
   00380 Tryptophan metabolism
    S23_42900
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    S23_42900
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S23_42900
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    S23_42900
Enzymes [BR:brs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     S23_42900
Exosome [BR:brs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S23_42900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAL77485
UniProt: I0G9P8
Position
4373766..4374962
Genome map
AA seq 398 aa AA seqDB search
MAEAADPVLIVSAARTPLGRFMGELSPLPAHKLGSHVIAAALERATLAPEKVDEVFMGCV
LPAGQGQAPARQAARAAGLPDATGATTVNKVCGSGMKATMLAHDIIRAGSAGIVVSGGME
SMSNAPYLLAKARGGYRVGHDRIIDHMMMDGLEDAYETGRSMGDFGEATAEAYQFTRKDQ
DAYAMETLSRARKAVEGGAFKAEIAPITLTEKAGPRIVANDEHPLKVDPAKIPGLKPAFR
ANGTITPAASSANADGAAALVLTKRSLADHNGLPALAEIKGHATHSQEPQWFTTAPIPAI
RKLLDKVGWSASDVDLFEINEAFAVVAMAAQRDLGIPREKLNIHGGACALGHPIGATGAR
LIVTLLHALEANNLKRGVAALCIGGGEATAIAVERLVH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagccgccgatcccgtcctcatcgtctccgccgcccgcaccccgctcggccgc
ttcatgggcgaattgtcgccacttcccgcgcacaagctcggttcccacgtgatcgcggcc
gcgttggagcgcgcaacactcgcgcccgagaaggtcgacgaggtcttcatgggctgcgtc
cttcccgccggccagggccaggcgccagcgcggcaggccgcgcgggccgcaggacttccc
gacgccactggcgccacgaccgtcaacaaggtctgcggctccggcatgaaggcgaccatg
ctggcgcacgacatcatccgcgcgggctcggccgggatcgtggtctctggcggcatggag
agcatgagcaacgcgccttatctgctggcgaaagcgcgcggcggctaccgcgtcggccat
gaccgcatcatcgaccacatgatgatggatggcctggaggacgcctacgagaccggccgt
tccatgggcgatttcggcgaggcgaccgctgaagcttatcagttcacccgcaaggaccag
gacgcctatgcgatggagacgctcagccgggcgcgcaaggcggtcgagggcggtgcgttc
aaggccgagatcgcgccgatcacgctgacggagaaagctggtccgcgcatcgtcgccaat
gacgagcacccgctgaaggtcgatcccgccaagatccccggattgaagccggcgttccgc
gccaatggcaccatcacgccggccgcctcctccgccaatgccgacggcgccgccgcactg
gtgctgacgaagcgctcgctcgcggaccacaacggcctgcccgcgctggccgagatcaag
ggccacgccacccacagccaggagccgcaatggttcaccaccgcgccgattccggcgatc
cgcaagctgctggacaaggtcggctggagcgctagtgacgtcgacctgttcgagatcaac
gaggccttcgccgtggtggcgatggcggcgcagcgcgatctcggcattccgcgtgagaag
ctgaacatccatggcggcgcctgcgcgctcggccatcccatcggcgccaccggtgcgcga
ttgatcgtgacgctgctgcacgcactcgaggccaacaacctcaagcgcggggtcgcggcg
ctctgcatcggcggcggcgaagccacggcgatcgcggtggagcgtctcgtgcactga

DBGET integrated database retrieval system