KEGG   Bradyrhizobium sp. S23321: S23_58960Help
Entry
S23_58960         CDS       T01796                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00071  Fatty acid degradation
brs00280  Valine, leucine and isoleucine degradation
brs00281  Geraniol degradation
brs00310  Lysine degradation
brs00360  Phenylalanine metabolism
brs00362  Benzoate degradation
brs00380  Tryptophan metabolism
brs00410  beta-Alanine metabolism
brs00627  Aminobenzoate degradation
brs00640  Propanoate metabolism
brs00650  Butanoate metabolism
brs00903  Limonene and pinene degradation
brs00930  Caprolactam degradation
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
brs01120  Microbial metabolism in diverse environments
brs01130  Biosynthesis of antibiotics
brs01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    S23_58960
   00650 Butanoate metabolism
    S23_58960
  Lipid metabolism
   00071 Fatty acid degradation
    S23_58960
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S23_58960
   00310 Lysine degradation
    S23_58960
   00360 Phenylalanine metabolism
    S23_58960
   00380 Tryptophan metabolism
    S23_58960
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S23_58960
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    S23_58960
   00281 Geraniol degradation
    S23_58960
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S23_58960
   00627 Aminobenzoate degradation
    S23_58960
   00930 Caprolactam degradation
    S23_58960
Enzymes [BR:brs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     S23_58960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAL79086
UniProt: I0GE99
Position
6096982..6097836
Genome map
AA seq 284 aa AA seqDB search
MSSFETILVERPEPAIARIVMNRPDARNAQNLQMTYDLNAAFDEAVQDDAVKVIILAGNG
PHFSSGHDLRPGGKNAAGVDFPPVGNWGGFAEPNAHGRFAREQEIYLQITRRWRNLAKPT
IAEVHGKCIAGGLMLVWACDLIVASDDAQFCDPVVTMGVCGVEWFVHPWELGPRKAKEFL
FTADSWSAEVAHQLGMVNQVVPRAELSARVLDLARRIASKPSFALKLTKEAVNRSVDVMG
QPAAIDQAFALHQLCHAHNLQEFGMVIDPSGLHPSVRKPPAAAE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgttcgagaccatcctcgtggaacggccggagccggcgatcgcccggatcgtg
atgaaccggcccgatgcgcgcaacgcgcagaacctgcaaatgacctacgacctcaatgcc
gcctttgacgaggcggtgcaggacgacgcggtcaaggtcatcatcctcgccggcaacggg
ccgcacttctcctccggccacgacctccgccccggtggcaagaatgccgcaggcgtcgat
tttccgccggtgggaaattggggcggctttgccgaacccaacgcgcacggccgcttcgcg
cgcgagcaggaaatctatctccagattacccggcgctggcgcaacctggcaaaaccgacc
attgccgaggtgcacggcaagtgcatcgccggcggcctgatgctggtatgggcctgcgac
ctcatcgtcgccagcgacgatgcgcagttctgcgatcccgtcgtcaccatgggcgtctgc
ggtgtcgagtggttcgtgcatccctgggagctcggcccgcgcaaagccaaggaattcctg
ttcaccgccgacagctggagcgccgaggtggcgcatcagctcggtatggtgaaccaggtc
gtgccgcgcgcggagttgtcggcgcgcgtgttggatctggcgcgccggatcgcatcgaag
ccgtcgtttgctctgaagctgaccaaggaagccgtcaaccgctcggtcgatgtgatgggc
cagccggccgcgatcgaccaggcctttgcgctgcatcagctctgtcacgctcacaatctt
caggagttcggcatggtgatcgatccatccggactgcatccctccgtgcgcaagccgccg
gcggccgcggagtag

DBGET integrated database retrieval system