KEGG   Bradyrhizobium sp. S23321: S23_63670Help
Entry
S23_63670         CDS       T01796                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00071  Fatty acid degradation
brs00072  Synthesis and degradation of ketone bodies
brs00280  Valine, leucine and isoleucine degradation
brs00310  Lysine degradation
brs00362  Benzoate degradation
brs00380  Tryptophan metabolism
brs00620  Pyruvate metabolism
brs00630  Glyoxylate and dicarboxylate metabolism
brs00640  Propanoate metabolism
brs00650  Butanoate metabolism
brs00900  Terpenoid backbone biosynthesis
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
brs01120  Microbial metabolism in diverse environments
brs01130  Biosynthesis of antibiotics
brs01200  Carbon metabolism
brs01212  Fatty acid metabolism
brs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:brs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    S23_63670
   00630 Glyoxylate and dicarboxylate metabolism
    S23_63670
   00640 Propanoate metabolism
    S23_63670
   00650 Butanoate metabolism
    S23_63670
  09103 Lipid metabolism
   00071 Fatty acid degradation
    S23_63670
   00072 Synthesis and degradation of ketone bodies
    S23_63670
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S23_63670
   00310 Lysine degradation
    S23_63670
   00380 Tryptophan metabolism
    S23_63670
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    S23_63670
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S23_63670
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    S23_63670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:brs04147]
    S23_63670
Enzymes [BR:brs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     S23_63670
Exosome [BR:brs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   S23_63670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAL79554
UniProt: I0GFL7
Position
6608664..6609836
Genome map
AA seq 390 aa AA seqDB search
MAEAYIVAAARTAGGRKGGRLAGWHPADLAAKVLDELVDRTKVDPALVEDVIMGCVMQVG
EQSNNVARNAIMASKLPESVPGTSIDRQCGSSQQALHFAAQAVMSGAMDVVIAAGVESMT
RVPMGLSSQLPAKNGFGNYKSPGIEHRYPNIVFSQFTGAEMMAEKYGLSKNELDEYSYNS
HQRAIAATQAGHFKKEIVPLEITRADGSKDTHHIDEGIRFDATLDGIKGVKLIAENGKLS
AASASQICDGASGVMVVNERGLKQLGVKPIARVHHMTMMGGDPVIMLDAPLHATKRALEK
SGMKIDDIDLFEVNEAFASVPTAWLKTTGADPERLNVNGGAIALGHPLGGSGTKLMTTLV
HALHQRGKRYGLQTMCEGGGMANVTIVERL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcatacatcgtcgccgctgcgcgtaccgccggcgggcgcaaggggggccgc
ctcgccggctggcatccggccgatctcgccgccaaggtactggacgagctggtcgaccgc
accaaggtcgatcccgccttggtcgaggacgtgatcatgggctgcgtcatgcaggtcggc
gagcagtcgaacaacgtcgcccgcaacgccatcatggcctcgaagctgccggagagtgtt
cccggcacctcgatcgaccgccagtgcggttcgtcgcagcaggcgctgcacttcgcggcg
caggccgtgatgtcgggcgcgatggacgtcgtgatcgcggccggcgttgaatcgatgaca
cgcgtgccgatggggctgtcgtcgcagctcccggccaagaacggctttggcaattacaag
agcccgggcatcgagcaccgttatccgaacatcgtgttcagccagttcaccggcgccgag
atgatggccgagaagtacggcctgtcgaagaacgagctcgacgagtactcctacaacagc
catcagcgcgcgatcgcggcgacccaggccggtcacttcaagaaggagatcgtgccgctc
gagatcacccgcgccgacggcagcaaggacacccaccacatcgacgagggcatccgtttc
gacgccacgctcgacggcatcaagggcgtcaagctgatcgccgagaacggcaagctgtcc
gcggccagcgccagccagatctgcgacggcgcctccggcgtcatggtggtgaacgagcgc
ggcctgaagcagctcggcgtgaagccgatcgcgcgcgtccaccacatgaccatgatgggc
ggcgaccccgtcatcatgctcgacgcgccgctgcatgccaccaagcgcgcgctggagaag
tccggcatgaagatcgatgacatcgatctgttcgaggtcaacgaggccttcgcctcggtg
ccgaccgcgtggctgaagaccaccggcgccgatccggagcgcctcaacgtcaatggcggc
gcgatcgcgctcggccatcccctcggcggctccggcaccaagctgatgacgactctggtc
cacgccctgcaccagcgcggcaagcgctatggtctccagaccatgtgcgaaggcggcggc
atggccaacgtgacgatcgtcgagcgactgtaa

DBGET integrated database retrieval system