KEGG   Bradyrhizobium sp. S23321: S23_66610Help
Entry
S23_66610         CDS       T01796                                 

Definition
(GenBank) phosphoglucomutase phosphomannomutase protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00010  Glycolysis / Gluconeogenesis
brs00030  Pentose phosphate pathway
brs00051  Fructose and mannose metabolism
brs00052  Galactose metabolism
brs00230  Purine metabolism
brs00500  Starch and sucrose metabolism
brs00520  Amino sugar and nucleotide sugar metabolism
brs00521  Streptomycin biosynthesis
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
brs01120  Microbial metabolism in diverse environments
brs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S23_66610
   00030 Pentose phosphate pathway
    S23_66610
   00051 Fructose and mannose metabolism
    S23_66610
   00052 Galactose metabolism
    S23_66610
   00500 Starch and sucrose metabolism
    S23_66610
   00520 Amino sugar and nucleotide sugar metabolism
    S23_66610
  Nucleotide metabolism
   00230 Purine metabolism
    S23_66610
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    S23_66610
Enzymes [BR:brs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     S23_66610
    5.4.2.8  phosphomannomutase
     S23_66610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: BAL79838
UniProt: I0GGF1
Position
complement(6904656..6906155)
Genome map
AA seq 499 aa AA seqDB search
MFPKPKSVLLPNTYAFESEPMVKATGFREYDARWLFQKEINLMGVQALGMGLGALIAELG
VGQEIVTGHDFRGYSASIKYALISGLMAAGCKVHDIGLAVTPMAYFAQFDLDVPCCAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMTRLKEIVLNADFKNKAGGSYQFHENYPARYIADL
TRRPKLTRKLKVVAACGNGTAGAFAPQVLEAIGCEVIPLDTELDYTFPKYNPNPEDMEML
HAIRDAVLQHKADVGLGFDGDGDRCGVVDNTGEEIFADKVGVMLARDMSAIHKDAQFIVD
VKSTGLFITDPVLQKQGARTTYWKTGHSYMKRRTHETGALAGFEKSGHFFFNKPYGRGYD
DGLVSALAICDMLDRAPGKSMADLKNALPKTWSSPTMSPHCADEIKYGVIDQVVKHFEDL
QAKGAKIGGQAIRDLVTVNGVRVTVEDGSWGLVRASSNKPELVVVVESPVSEQRMHDMFE
MVNSVLRTHPEVGEYNQKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccaagccgaaatccgtattgttgcccaacacctacgccttcgaatccgagccg
atggtgaaggccacgggtttccgcgaatacgacgcgcgctggttgttccagaaggaaatc
aacctaatgggggtgcaggcgctcggcatggggctgggtgcgctgatcgcggagctcggc
gtcggccaggagatcgtcaccggccatgatttccgcggctactcggcctcgatcaaatac
gcgctgatctccggcctgatggcggcaggctgcaaggtgcacgacatcgggcttgccgtg
acgccgatggcctatttcgcgcagttcgatctcgacgtgccctgctgcgccatggtcacc
gcttcgcacaacgacaatggctggaccggtgtgaagatgggtgccaaccgcccgctgacc
ttcggccccgacgagatgacgcggctgaaggagatcgtgctcaacgccgatttcaagaac
aaggccggcggctcctaccagttccacgaaaactatccggcgcgttacatcgccgatctc
accaggcgtcccaagctgacgcgcaagctcaaggtcgtcgcggcctgtggcaacggcacg
gccggcgcattcgcgccgcaggtgctggaggcgatcggctgcgaggtgatcccgctcgac
accgagctcgactacactttcccgaaatacaatccgaaccccgaagacatggagatgctg
cacgcgatccgtgatgcggtgctgcagcacaaggccgatgtcggtctcggcttcgacggt
gacggcgaccgctgtggcgtcgtcgacaacaccggcgaggaaatcttcgccgacaaggtc
ggcgtgatgctggcgcgcgacatgtcggcgatccacaaggacgcgcagttcatcgtcgac
gtgaagtcgaccggcctcttcatcaccgatccggtgttgcagaagcagggcgccaggacc
acctattggaagaccggtcattcctacatgaagcgccgcacccacgagacgggcgcgctc
gccggcttcgagaagtccggccacttcttcttcaacaagccatatggacgcggctatgac
gacggcctggtctcggcgctcgcgatctgcgacatgctcgaccgtgcgcccggcaagtcg
atggcggatctgaagaacgcgctgccaaaaacctggtcatcgccgacgatgtcgccgcat
tgcgccgacgagatcaaatacggcgtcatcgatcaggtcgtgaagcatttcgaggattta
caggcgaagggtgcgaagatcggcggccaggcgatccgcgatctcgtcaccgtcaacggc
gtgcgcgtcacggtcgaggacggcagctggggcctggtgcgagcctcctccaacaagccc
gagctcgtcgtcgtggtcgagagcccggtctccgagcagcgcatgcacgacatgttcgag
atggtgaacagcgtgctgcgcacccatcccgaggtcggcgagtacaatcagaagatctga

DBGET integrated database retrieval system