KEGG   Brucella sp. 2002734562: BFS01_10650Help
Entry
BFS01_10650       CDS       T05682                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bru  Brucella sp. 2002734562
Pathway
bru00260  Glycine, serine and threonine metabolism
bru01100  Metabolic pathways
bru01110  Biosynthesis of secondary metabolites
bru01120  Microbial metabolism in diverse environments
bru01130  Biosynthesis of antibiotics
bru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BFS01_10650
Enzymes [BR:bru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BFS01_10650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOG44884
Position
2:complement(44936..45985)
Genome map
AA seq 349 aa AA seqDB search
MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFNELFEREVAVFFVGTGT
AANSLALASVNRPGGVSLVHREAHVIEDGCGAPEYFTGGARLHPIDGALGRIDPELLKRE
LKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQICRDAGLPLHMDGARFANALV
SLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDPARAKDLPFIRKRAAQLFSKTRF
VAAQFDAYLRDDLWRDLARHSNALAARLANHIHASSQMRLAWKPEANEVFAIMKQSVYDR
LRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTSFANTEEEVDRFGDMIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgcattttgcgtcagacaattgggcaggcgcccatccaaaaatcgccgagagcctttcg
ctgcatgcagccggttttgcggcagcctatggcgcaagcgagatcgacaaacgtgtggaa
caacacttcaatgaattgttcgagcgtgaagtggccgttttctttgtcggaaccggtacg
gctgccaattcgctggcgctggccagcgtcaaccggcccggcggcgtttcgctggtccac
cgcgaggcgcatgtgatcgaggatggatgcggcgcaccggaatatttcaccggcggcgca
cgtctccacccgatcgacggcgcgctgggccgcattgatcccgaacttctgaaacgcgaa
ttgaagcgtttcaaccccgccttcgttcacgcgggccagcccatggccgtcagcatcacg
caggcgacggaagtgggtacgctttaccagccggagcatatcgccaccatttcgcaaatc
tgccgcgatgccggactgccgctacacatggatggcgcacgctttgccaatgcgctcgtg
tcgcttgatctcacacctgccgaaatgacatggaaacttggcgtggacattgtgtccttc
ggcggcaccaagaatggctgctggtgcgccgaggcgctggtcttcatggacccggcccgc
gccaaagacctgcccttcatccgcaagcgcgcagcacagcttttctccaagacgcgcttc
gttgccgcgcagttcgatgcctatctgcgtgacgatctctggcgcgaccttgcccgccat
tccaacgcgcttgctgcccgccttgccaaccatatccatgcatcaagccagatgcgcctt
gcctggaaaccggaagccaacgaggttttcgcgatcatgaagcaatcggtttatgaccgt
ctgcgcgatgcgggtgcggtattctacgactggaatcctccgcattcggaagtgggccgc
atcggcgagggcgagatttttgcccgctttgtcaccagcttcgccaatacggaagaagaa
gtggaccgtttcggcgacatgatcgcctga

DBGET integrated database retrieval system